DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi15 and Osi12

Sequence 1:NP_649636.1 Gene:Osi15 FlyBaseID:FBgn0037424 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_649631.1 Gene:Osi12 FlyBaseID:FBgn0037419 Length:295 Species:Drosophila melanogaster

Alignment Length:260 Identity:60/261 (23%)
Similarity:98/261 (38%) Gaps:75/261 (29%)


  Fly     8 VVLLASLVCGSMA---------LPSQDNTERDL----------------------VNMLNRLDSE 41
            |:.||| .||:..         .|||....|.|                      ::.::||...
  Fly    17 VLFLAS-SCGAATEQLGSPPGPSPSQSAGARTLLRVYDECTRAEAGFVPCLKKKAISFIDRLAPI 80

  Fly    42 ESVALFGGLRIDRSE-------------------SGRSFGASKAVESFEDRAERYLETHELNLSF 87
            :::.:..|:::.|.|                   ||....| |......:|...:...|.|.:||
  Fly    81 DAINVAEGIKLVRLETAPRPPATSENELESSLPRSGSDRDA-KLTNMLIERLSYFFNGHSLQVSF 144

  Fly    88 SGDEQDENSENEYTGRAMDESRSKRMKKMLLPLLLALKLKKAVVVKIMFTIIKFISLKALAISFL 152
            .....||      .||.::|.|.| ||||:..:::.:.:|...::.|....:..::.|||.||.:
  Fly   145 PKLTSDE------IGRGLEEGRGK-MKKMMGMMMMGMAMKMMGMIPIAMGALYILAGKALIISKI 202

  Fly   153 ALILAGATFFKDLLAKKKEHITTAYITGSPLNADIVHSDWSRNGQAG------------AADLAY 205
            ||:|||....|.|::.|....::.:.:|.....    ..||..|..|            |.:|||
  Fly   203 ALLLAGIIGLKKLMSGKSSGGSSGWSSGGGGGG----GGWSSGGGGGGGGGWDRRSLTEAQELAY 263

  Fly   206  205
              Fly   264  263

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi15NP_649636.1 DUF1676 31..163 CDD:311725 38/173 (22%)
Osi12NP_649631.1 DUF1676 74..159 CDD:285181 19/92 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.