DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi15 and Osi11

Sequence 1:NP_649636.1 Gene:Osi15 FlyBaseID:FBgn0037424 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_649630.1 Gene:Osi11 FlyBaseID:FBgn0037418 Length:302 Species:Drosophila melanogaster

Alignment Length:234 Identity:54/235 (23%)
Similarity:88/235 (37%) Gaps:62/235 (26%)


  Fly     9 VLLASLVCGSMALPS---QDNTERDL-------------------------VNMLNRLDSEESVA 45
            :|||:....:|..||   |::||..|                         |.:|.|......:.
  Fly    11 LLLAAFQAWAMEAPSNYNQNSTESGLLRTVRHIYGQCAYSEDVFWCCKIQGVRLLGRALKVPQLG 75

  Fly    46 LFGGLRIDRSES----GRSFGASKAVES------------------FEDRAERYLETHELNLSFS 88
            :..|:.:.|.||    .|| |.|..:||                  ..:|...::.:|:|.::..
  Fly    76 IVDGVSLVRRESFTQDTRS-GRSSLLESQLSNRDLEHLSGKSLDALLLERFLNFVHSHQLQVNLP 139

  Fly    89 -----GDEQDENSENEYTGRAMDESRS-----KRMKKMLLPLLLALKLKKAVVVKIMFTIIKFIS 143
                 |:...::......|..|..|.|     |..||.|.|.:.|:.||.| ::|:.:..|..::
  Fly   140 RLLRFGERNVQDWLLHVVGYFMPASESEGRKKKDDKKYLGPFIAAVLLKTA-ILKMAYHSIAIVA 203

  Fly   144 LKALAISFLALILAGATFFKDLLAKKKEHITTAYITGSP 182
            .|||.:..:|||::.....|.|:.......||..|...|
  Fly   204 GKALIVGKIALIISAIIGLKKLVGHDGGEKTTYEIVKHP 242

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi15NP_649636.1 DUF1676 31..163 CDD:311725 39/189 (21%)
Osi11NP_649630.1 DUF1676 65..180 CDD:285181 24/116 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.