DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi15 and Osi10

Sequence 1:NP_649636.1 Gene:Osi15 FlyBaseID:FBgn0037424 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_731058.1 Gene:Osi10 FlyBaseID:FBgn0037417 Length:576 Species:Drosophila melanogaster

Alignment Length:175 Identity:44/176 (25%)
Similarity:65/176 (37%) Gaps:52/176 (30%)


  Fly    29 RDLVNMLNRLDSEESVALFGGLRIDRSESGRSFGASKAVES--------FED----RAERYLETH 81
            |..:|.:.:||..::|.........:||:......|..:::        .|:    ..:|.:|.|
  Fly    46 RSALNFIQKLDESDNVKFVEDFVTVKSETAAVRSLSNVLDTDPVDFRGILENAGAVMGQRSMEWH 110

  Fly    82 ----ELNLSFS-GDEQDENSENEY------------------TGRAMDESRSKRMKKMLLPLLLA 123
                ...|.|. |...|.||..|:                  |||.:       .|:.|||.||.
  Fly   111 MDGLYPGLMFKIGPTADANSVAEFVLDGAAQGERQFGFEDPSTGRVL-------TKQYLLPFLLG 168

  Fly   124 LKLKKAVVVKIMFTII-----KFISLKALAI---SFLAL--ILAG 158
            ||.....:|.::|..|     |.:.|..|||   |||.|  |:.|
  Fly   169 LKFNLVALVPLIFAGICLLLKKSLFLVKLAIYVSSFLGLGGIVGG 213

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi15NP_649636.1 DUF1676 31..163 CDD:311725 43/174 (25%)
Osi10NP_731058.1 DUF1676 42..203 CDD:311725 38/164 (23%)
DUF1676 355..487 CDD:311725
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.