DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi15 and Osi9

Sequence 1:NP_649636.1 Gene:Osi15 FlyBaseID:FBgn0037424 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_649628.2 Gene:Osi9 FlyBaseID:FBgn0037416 Length:233 Species:Drosophila melanogaster

Alignment Length:249 Identity:73/250 (29%)
Similarity:101/250 (40%) Gaps:64/250 (26%)


  Fly     4 KFVCV-VLLASLVCGSMALPS---------QDNTERDLV-----NMLNRLDSE-------ESVAL 46
            ||||: .|:||....:....|         :|..||.:|     ..|:..|:|       |.:||
  Fly     3 KFVCLFALIASTAAATSEADSLLTSALKMVKDCGERSMVLCMKERALHYFDAENGDVRLTEGIAL 67

  Fly    47 FGGLRIDRSESGRSFGASKAVESFE-----------DRAERYLETHELNLSFSGDE-QDENSENE 99
               ::.|....|||....:..|..|           :|..|:..||.|......|. ||..    
  Fly    68 ---VKTDEIPVGRSLNEMQLPEEVEAREAEVDSLLVERVARFFGTHTLQFKVPKDSIQDMQ---- 125

  Fly   100 YTGRAMDESRSKR--MKKMLLPLLLALKLKKAVVVKIMFTIIKFISLKALAISFLALILAGATFF 162
               ||::|||.|:  .||.|:|||:..|||.|.::.:....:..||.|||.|..:||:|:|....
  Fly   126 ---RALEESRGKKKEKKKYLMPLLMLFKLKMAALLPLAIGFLALISFKALVIGKIALLLSGIIGL 187

  Fly   163 KDLLAKKKE--------HITTAYITGSPLNADIVHSDWSRNGQAGAADLAYNHY 208
            |.||..|||        |....:..|..|.:|          .:.|..|||..|
  Fly   188 KKLLESKKENYEVVAHPHYEHEHSYGRSLPSD----------DSQAQQLAYAAY 231

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi15NP_649636.1 DUF1676 31..163 CDD:311725 47/158 (30%)
Osi9NP_649628.2 DUF1676 54..144 CDD:285181 27/100 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.