DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi15 and Osi8

DIOPT Version :9

Sequence 1:NP_649636.1 Gene:Osi15 / 40771 FlyBaseID:FBgn0037424 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_649627.1 Gene:Osi8 / 40762 FlyBaseID:FBgn0037415 Length:274 Species:Drosophila melanogaster


Alignment Length:221 Identity:56/221 - (25%)
Similarity:84/221 - (38%) Gaps:68/221 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SQDNTERDL-VNMLNRLD----SEESVALFGGLRIDRSESGRSFGASKAVESFED---------- 72
            |.||....| |.:|..|:    |.:|::|..|::. .|..|.|....:|..|.:|          
  Fly    69 SGDNMSVCLKVKLLTGLEKAFRSAKSLSLMEGIQF-VSSGGESEETKRAPISEKDIEAVLPRSVD 132

  Fly    73 ------------RAERYLETHELNLSFSGDEQDENSENEYTGRAMDESRSKRMKK-----MLLPL 120
                        |...:|:.|.|.:.|      :|..|..      |.|.|:.||     :::||
  Fly   133 AKEQVLNNMILKRVGNFLQDHTLQVKF------DNEANSV------EGRKKKEKKGNGAMIMIPL 185

  Fly   121 LLALKLKKAVVVKIMFTIIKFISLKALAISFLALILAGATFFKDLLA-----KKKEHITTAYITG 180
            ||.     ..:|.:.:..:..::.|||.:|.|||:||.....|.||:     |:..|.......|
  Fly   186 LLG-----GTIVPLAYGALAMLAGKALIVSKLALVLASIIGIKKLLSGGGGGKESSHEVVVSSGG 245

  Fly   181 SPLNADIVHSDWSRNGQAGAADLAYN 206
                    ||.|.|.     .|.||:
  Fly   246 --------HSGWGRE-----LDTAYS 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi15NP_649636.1 DUF1676 31..163 CDD:462310 40/163 (25%)
Osi8NP_649627.1 DUF1676 67..222 CDD:462310 43/170 (25%)


Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.