DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi15 and Osi7

Sequence 1:NP_649636.1 Gene:Osi15 FlyBaseID:FBgn0037424 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_649626.1 Gene:Osi7 FlyBaseID:FBgn0037414 Length:288 Species:Drosophila melanogaster

Alignment Length:291 Identity:73/292 (25%)
Similarity:117/292 (40%) Gaps:99/292 (34%)


  Fly     6 VCVVLLASLVCGSMALPSQDNT---------ERDLVNMLN----RLDS----------------- 40
            :|:|.|      |.|||:::..         |.|:::.:.    |.||                 
  Fly    11 LCLVAL------SAALPAEETRGHARNAIGGENDIMDSIYSDCLRKDSVSCVKYKLFSFVDKVLG 69

  Fly    41 -EESVALFGGLRIDRS------ESGRSFGASKAVESFE-DRAERYLETHELNLSFSGDE--QDEN 95
             .:..||..|:.:.||      |:.||....::.||.. :|...:|.:|.:.:...|.:  |..:
  Fly    70 ARDQFALTEGVTVVRSPDAPQQEAARSISGDESFESLALNRISSFLNSHTIKVELKGADIVQAVS 134

  Fly    96 SENEYTGRAM----------------DESRSKRMK--KMLLPLLLALKLKKAVVVKIMFTIIKFI 142
            |    ||||:                :|||.|:.|  |:|.|:|..:.||.|.::.::...|..|
  Fly   135 S----TGRALEDASESLFGSNDPNAPEESRGKKKKAAKILGPILALVALKAAALLPLLLGAIALI 195

  Fly   143 SLKALAISFLALILAGATFFKDLLAKKKEHITTAYIT---------------GSPLNADI----- 187
            :.|||.|..:||:|:.....|.||:::| |:|...:.               ||..:||.     
  Fly   196 AGKALLIGKIALVLSAVIGLKKLLSQEK-HVTYEVVAHPHHSSSHSTSHDSYGSGYSADAGASSA 259

  Fly   188 -----VHSDWSRNGQAGAADLAYNHYGLAQP 213
                 .|..|.|:  ..|.|||   ||..:|
  Fly   260 SYGSSGHGGWGRS--IDAQDLA---YGAQKP 285

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi15NP_649636.1 DUF1676 31..163 CDD:311725 44/181 (24%)
Osi7NP_649626.1 DUF1676 68..172 CDD:285181 27/108 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.