DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi15 and Osi4

DIOPT Version :9

Sequence 1:NP_649636.1 Gene:Osi15 / 40771 FlyBaseID:FBgn0037424 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001262305.1 Gene:Osi4 / 40758 FlyBaseID:FBgn0037412 Length:395 Species:Drosophila melanogaster


Alignment Length:133 Identity:30/133 - (22%)
Similarity:52/133 - (39%) Gaps:33/133 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 GRAMDESRSKRMKKMLLPLLLA-------LKLKKAVVVKIMFTIIKFISLKALAISFLALILAGA 159
            ||...:.:.|:..:|.:|:.||       :...|||         ..::||||.:|.:|.::|..
  Fly   201 GRRRHQHQDKKQFQMFIPMYLAATTFGWTMVAAKAV---------GLLTLKALILSKIAFVVAAI 256

  Fly   160 TFFKDLLAKKKEHI------TTAY---------ITGSPLNADIVHSDWSRNGQAGAADLAYN--H 207
            ...|.|:....|.:      .|.|         :.|:.::.::..|.......||...|..:  |
  Fly   257 VLIKKLMDNASEKMMYQFPEQTPYMMPYGMDYPLHGAEISPEMYPSSLHHLAMAGGGQLPGHPGH 321

  Fly   208 YGL 210
            .||
  Fly   322 PGL 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi15NP_649636.1 DUF1676 31..163 CDD:311725 17/67 (25%)
Osi4NP_001262305.1 DUF1676 <210..261 CDD:311725 15/59 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.