DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi15 and Osi2

Sequence 1:NP_649636.1 Gene:Osi15 FlyBaseID:FBgn0037424 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001262303.1 Gene:Osi2 FlyBaseID:FBgn0037410 Length:390 Species:Drosophila melanogaster

Alignment Length:106 Identity:28/107 (26%)
Similarity:51/107 (48%) Gaps:16/107 (15%)


  Fly    73 RAERYLETHELNLS--------------FSGDEQDENSENEYTGRAMDESRSKRMKKMLLPLLLA 123
            ||||::::..|.:.              |.|::.|...:....|:.......|::|||::||||.
  Fly   164 RAERFIKSTALEVEWPEELTEAGRYEARFIGNDIDGELDLIDDGQRAGHFSRKKLKKMIIPLLLV 228

  Fly   124 LKLKKAVVVKIMFTIIKFISLKALAISFLALILAGA-TFFK 163
            ||:.|..::..:..|:....||.: :...|::|.|. .:||
  Fly   229 LKIFKLKLLLFLPFILGIAGLKKI-LGLAAIVLPGLFAYFK 268

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi15NP_649636.1 DUF1676 31..163 CDD:311725 27/105 (26%)
Osi2NP_001262303.1 DUF1676 108..224 CDD:285181 13/60 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.