DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi15 and Osi21

Sequence 1:NP_649636.1 Gene:Osi15 FlyBaseID:FBgn0037424 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_609501.1 Gene:Osi21 FlyBaseID:FBgn0283678 Length:282 Species:Drosophila melanogaster

Alignment Length:154 Identity:35/155 (23%)
Similarity:69/155 (45%) Gaps:27/155 (17%)


  Fly    32 VNMLNRLDSEESVALFGGLRIDR-----SES-------GRSFGASKAVE-SFEDRAERYLETHEL 83
            ::.|:|...::|:.:..||.:::     :||       .|.||....:: :...:|::.:.||.|
  Fly    76 LHALSRALDQDSIKIVDGLALEKQNQSETESILGSLTDARQFGNLSPIDRALLSKADKLMRTHTL 140

  Fly    84 NLSFSGDEQDENSENEYTGRAMDESRSK-----RMKKMLLPLLLALKLKKAVVVKIMFTIIKFIS 143
            .:     :.|.....:..||.....:.|     .:|.::..||.|:.:...:.:|.:..    |:
  Fly   141 KI-----DMDVGGGEDSVGREHGHKKKKHKEGGHIKYVVAALLTAMGIAGPLGLKALAA----IA 196

  Fly   144 LKALAISFLALILAGATFFKDLLA 167
            .|||.||.:||.:||....|.|.:
  Fly   197 GKALVISKVALTIAGIIALKKLFS 220

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi15NP_649636.1 DUF1676 31..163 CDD:311725 33/149 (22%)
Osi21NP_609501.1 DUF1676 79..>152 CDD:285181 15/78 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.