DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi15 and Osi16

Sequence 1:NP_649636.1 Gene:Osi15 FlyBaseID:FBgn0037424 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_731065.1 Gene:Osi16 FlyBaseID:FBgn0051561 Length:278 Species:Drosophila melanogaster

Alignment Length:214 Identity:40/215 (19%)
Similarity:77/215 (36%) Gaps:44/215 (20%)


  Fly    30 DLVNMLNRLDSEESVALFGGLRIDRSESGRSFGAS----KAVESFED------------RAERYL 78
            :.|.::.:|..:|.:.:..|:.:.:.|:......|    :...|:..            :.|..|
  Fly    67 EFVKIMEKLAEQEELNVLPGISVVKDENATELKTSELMAEVARSYPSDPSTRLNGYIVAKLENLL 131

  Fly    79 ETHELNLSFSGDEQDENSENEYTGRAMDESRSKRMKKM--LLPLLLALKLKKAVVVKIMFTIIKF 141
            .|..|......|            :::.|.|..:..|.  |..|:.|..:.|.:::.:....|..
  Fly   132 RTRFLRFRLLDD------------KSLVEGRKHKFGKKGGLEALVAAGVMMKGMLMAMGLGAIAL 184

  Fly   142 ISLKALAISFLALILAGATFFKDLLAKKKEHITTAYITGSPL-----NADIVHSD--------WS 193
            ::.|||..:.:||.|:|....|. ||......||..|...|:     :..:.|.|        ::
  Fly   185 MAGKALMTALMALTLSGVLGLKS-LAGGGGKSTTYEIVAKPIYTSSHSHSVTHEDGGHSHSPHFA 248

  Fly   194 RNGQAGAADLAYNHYGLAQ 212
            ..|..|.....:.:.|.|:
  Fly   249 AGGGGGGTASGFGYGGYAR 267

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi15NP_649636.1 DUF1676 31..163 CDD:311725 27/150 (18%)
Osi16NP_731065.1 DUF1676 72..156 CDD:285181 13/96 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.