DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi14 and Osi23

DIOPT Version :10

Sequence 1:NP_649635.1 Gene:Osi14 / 40770 FlyBaseID:FBgn0040279 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_651794.2 Gene:Osi23 / 43615 FlyBaseID:FBgn0039771 Length:255 Species:Drosophila melanogaster


Alignment Length:209 Identity:48/209 - (22%)
Similarity:81/209 - (38%) Gaps:37/209 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 CLES---DDMATCLAVKGITALNRAARSNNIELASGVTFQRDPASPVSRTGKSMSEQDVYAELPQ 105
            |.:|   ..:.:|...:.:........|..|.:..||.....|.|..:.|......:|:      
  Fly    45 CYQSGIHQSLWSCFRSRSLHIFEGIMSSPEISIYDGVRLVAAPNSTDNATRPDDERKDL------ 103

  Fly   106 NADERTGRLVDLAVSSAADFLSTHNLEFKLPAETTQQVARALDE----GRGKIKK---------M 157
               :.......||||.|.. |:||.|:..|...|.:.::.....    |..::::         |
  Fly   104 ---KHLTWFDQLAVSLAKG-LTTHTLQVNLGKLTERYLSSDTSNPDPVGSARVRRHRYNMIITMM 164

  Fly   158 LGPVALAIGAKLFAVIPLVLGFLALLTFKAVIVAKLAFFLAILVGGSRLLGGFGNKFG-----GN 217
            .|..||  ||.|   :|:....|::::.||:::||:|..||.:.|..|:... |..:|     |.
  Fly   165 FGVTAL--GAIL---VPMGFQMLSIVSGKALLLAKMALLLASINGLKRVANN-GLHYGLYHVPGE 223

  Fly   218 SFAGAYNSNAWSAP 231
            ...|.|:....|.|
  Fly   224 HLGGYYDRGDVSHP 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi14NP_649635.1 DUF1676 44..202 CDD:462310 39/173 (23%)
Osi23NP_651794.2 DUF1676 44..207 CDD:462310 40/176 (23%)

Return to query results.
Submit another query.