DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi14 and Osi23

DIOPT Version :9

Sequence 1:NP_649635.1 Gene:Osi14 / 40770 FlyBaseID:FBgn0040279 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_651794.2 Gene:Osi23 / 43615 FlyBaseID:FBgn0039771 Length:255 Species:Drosophila melanogaster


Alignment Length:209 Identity:48/209 - (22%)
Similarity:81/209 - (38%) Gaps:37/209 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 CLES---DDMATCLAVKGITALNRAARSNNIELASGVTFQRDPASPVSRTGKSMSEQDVYAELPQ 105
            |.:|   ..:.:|...:.:........|..|.:..||.....|.|..:.|......:|:      
  Fly    45 CYQSGIHQSLWSCFRSRSLHIFEGIMSSPEISIYDGVRLVAAPNSTDNATRPDDERKDL------ 103

  Fly   106 NADERTGRLVDLAVSSAADFLSTHNLEFKLPAETTQQVARALDE----GRGKIKK---------M 157
               :.......||||.|.. |:||.|:..|...|.:.::.....    |..::::         |
  Fly   104 ---KHLTWFDQLAVSLAKG-LTTHTLQVNLGKLTERYLSSDTSNPDPVGSARVRRHRYNMIITMM 164

  Fly   158 LGPVALAIGAKLFAVIPLVLGFLALLTFKAVIVAKLAFFLAILVGGSRLLGGFGNKFG-----GN 217
            .|..||  ||.|   :|:....|::::.||:::||:|..||.:.|..|:... |..:|     |.
  Fly   165 FGVTAL--GAIL---VPMGFQMLSIVSGKALLLAKMALLLASINGLKRVANN-GLHYGLYHVPGE 223

  Fly   218 SFAGAYNSNAWSAP 231
            ...|.|:....|.|
  Fly   224 HLGGYYDRGDVSHP 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi14NP_649635.1 DUF1676 62..160 CDD:285181 21/110 (19%)
Osi23NP_651794.2 DUF1676 66..163 CDD:285181 20/106 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.