DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi14 and Osi13

Sequence 1:NP_649635.1 Gene:Osi14 FlyBaseID:FBgn0040279 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_649634.1 Gene:Osi13 FlyBaseID:FBgn0037422 Length:210 Species:Drosophila melanogaster

Alignment Length:139 Identity:36/140 (26%)
Similarity:60/140 (43%) Gaps:29/140 (21%)


  Fly    86 PVSRTGKSM-------SEQDVYAELPQNADERTGRLVDLAVSS-AADFLSTHNLEFKLPAETTQQ 142
            ||.:.|.::       :||:..||..|..:.....:.:..:.| ..|.|||..:...|...:|  
  Fly    27 PVVQMGGAIVAAVEQDAEQEAAAEERQRVERHWLSMAETQLHSLITDDLSTEEVNNMLETWST-- 89

  Fly   143 VARALDEGRGKIK------KMLGPVALAIGAKLFAVIPLVLGFLALLTFKAVIVAKLAFFLA--- 198
                  |||||.|      ||:.|:..|:......::||:|.:|..|:..:.::.|:|...:   
  Fly    90 ------EGRGKHKKQKKLMKMVYPLLAAVAVAKVVLLPLILKWLTALSTSSFVMGKIALVTSGIL 148

  Fly   199 ----ILVGG 203
                ||.||
  Fly   149 ALKWILSGG 157

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi14NP_649635.1 DUF1676 62..160 CDD:285181 23/88 (26%)
Osi13NP_649634.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.