DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi14 and Osi7

Sequence 1:NP_649635.1 Gene:Osi14 FlyBaseID:FBgn0040279 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_649626.1 Gene:Osi7 FlyBaseID:FBgn0037414 Length:288 Species:Drosophila melanogaster

Alignment Length:314 Identity:82/315 (26%)
Similarity:138/315 (44%) Gaps:88/315 (28%)


  Fly     4 FAIACVTLLAASCVFAAPSVQDNQVEGDNTLGRAARYLGA-----------CLESDDMATCLAVK 57
            |.:.|:..|:|    |.|:        :.|.|.|...:|.           ||..|.: :|:..|
  Fly     8 FGVLCLVALSA----ALPA--------EETRGHARNAIGGENDIMDSIYSDCLRKDSV-SCVKYK 59

  Fly    58 GITALNR--AARSNNIELASGVTFQRDPASPVSRTGKSMSEQDVYAELPQNADERTGRLVDLAVS 120
            ..:.:::  .|| :...|..|||..|.|.:|.....:|:|..:.:.              .||::
  Fly    60 LFSFVDKVLGAR-DQFALTEGVTVVRSPDAPQQEAARSISGDESFE--------------SLALN 109

  Fly   121 SAADFLSTHNLEFKLP-AETTQQVA---RAL----------------DEGRGKIK---KMLGPVA 162
            ..:.||::|.::.:|. |:..|.|:   |||                :|.|||.|   |:|||:.
  Fly   110 RISSFLNSHTIKVELKGADIVQAVSSTGRALEDASESLFGSNDPNAPEESRGKKKKAAKILGPIL 174

  Fly   163 LAIGAKLFAVIPLVLGFLALLTFKAVIVAKLAFFLAILVGGSRLLG---------------GFGN 212
            ..:..|..|::||:||.:||:..||:::.|:|..|:.::|..:||.               ...:
  Fly   175 ALVALKAAALLPLLLGAIALIAGKALLIGKIALVLSAVIGLKKLLSQEKHVTYEVVAHPHHSSSH 239

  Fly   213 KFGGNSFAGAYNSNAWSAPASAGWSSGASSSYPYARSISEDGSDAQQLAYAGQQ 266
            ....:|:...|:::|.::.||.| |||...   :.|||     |||.|||..|:
  Fly   240 STSHDSYGSGYSADAGASSASYG-SSGHGG---WGRSI-----DAQDLAYGAQK 284

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi14NP_649635.1 DUF1676 62..160 CDD:285181 31/123 (25%)
Osi7NP_649626.1 DUF1676 68..172 CDD:285181 31/119 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2AK5C
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.