DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi14 and Osi4

DIOPT Version :9

Sequence 1:NP_649635.1 Gene:Osi14 / 40770 FlyBaseID:FBgn0040279 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001262305.1 Gene:Osi4 / 40758 FlyBaseID:FBgn0037412 Length:395 Species:Drosophila melanogaster


Alignment Length:366 Identity:75/366 - (20%)
Similarity:116/366 - (31%) Gaps:133/366 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LAASCVFAAPSVQ-----DNQVEGDNTL-----GRAARYLGACLESDDM-----------ATCL- 54
            |.|||:..|..:.     .::..|.|:|     |:.|......:|:.|:           |:|| 
  Fly     5 LVASCLLLALGLNMSLAAIHKRSGANSLGVDPEGKPAANPAVSVENTDLLDKLSWKCANNASCLY 69

  Fly    55 -AVKGITALNRAARSNNIELASGVTFQRDPASPVSR-----TGKSMSE-QDVYAELPQNADE-RT 111
             ...|:.|..|...:..:.|...|..   |....||     ||:.:|. .|...|   ||.. ..
  Fly    70 GVANGLMASYRRGETLKLGLFDLVKL---PELDASRKHKWGTGRGLSGFMDFVTE---NAIRVPV 128

  Fly   112 GRLVDLAVSSAADFLSTHNLEFKLPAETTQQVARALDEGRGKI---------------------- 154
            |.:| .:|..|.|  .:..:|..|..:|:....|....|.|.:                      
  Fly   129 GPMV-FSVQRAED--DSDYIEVALLKKTSSSTGRLQVNGGGLLGGGGGLGGNGGGGGGLLGGGGG 190

  Fly   155 -------------------KK---MLGPVALAIGAKLFAVIPLVLGFLALLTFKAVIVAKLAFFL 197
                               ||   |..|:.||  |..|....:....:.|||.||:|::|:||.:
  Fly   191 DNGGGGGLLGGRRRHQHQDKKQFQMFIPMYLA--ATTFGWTMVAAKAVGLLTLKALILSKIAFVV 253

  Fly   198 AILVGGSRLLGGFGNKF----------------------------------------GGNSFAGA 222
            |.:|...:|:.....|.                                        ||....| 
  Fly   254 AAIVLIKKLMDNASEKMMYQFPEQTPYMMPYGMDYPLHGAEISPEMYPSSLHHLAMAGGGQLPG- 317

  Fly   223 YNSNAWSAPASAGWSSGASSSYPYARSISEDGSDAQQLAYA 263
                   .|...|..|.::.|:.::..:|.|||:..|:..|
  Fly   318 -------HPGHPGLESLSAESHLHSAQVSSDGSNNTQVLAA 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi14NP_649635.1 DUF1676 62..160 CDD:285181 27/148 (18%)
Osi4NP_001262305.1 DUF1676 <210..261 CDD:311725 19/52 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.