DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi5 and Osi17

Sequence 1:NP_649624.1 Gene:Osi5 FlyBaseID:FBgn0037413 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_001262307.1 Gene:Osi17 FlyBaseID:FBgn0037427 Length:750 Species:Drosophila melanogaster

Alignment Length:46 Identity:13/47 (28%)
Similarity:19/47 (40%) Gaps:20/47 (43%)


  Fly   158 LGLKTAAQHGGESSHSIS--------------------YVTGEGHH 183
            |.::.:||....||||::                    ||.|:|||
  Fly   518 LQMQLSAQKVQASSHSLNPFQSQDKQSSRPAHTQHHPVYVPGQGHH 563

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi5NP_649624.1 DUF1676 <55..121 CDD:285181
RCR 184..>201 CDD:304939 13/47 (28%)
Osi17NP_001262307.1 DUF1676 180..270 CDD:285181
Prefoldin 603..>680 CDD:298833
DM4_12 661..745 CDD:299813
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.