DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi5 and Osi14

Sequence 1:NP_649624.1 Gene:Osi5 FlyBaseID:FBgn0037413 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_649635.1 Gene:Osi14 FlyBaseID:FBgn0040279 Length:268 Species:Drosophila melanogaster

Alignment Length:281 Identity:66/282 (23%)
Similarity:98/282 (35%) Gaps:101/282 (36%)


  Fly     3 RTFPLLCLLFLTA-------------VRSEN-----------C--DQDAGATLYCRGERALRNVL 41
            :.|.:.|:..|.|             |..:|           |  ..|....|..:|..||....
  Fly     2 KVFAIACVTLLAASCVFAAPSVQDNQVEGDNTLGRAARYLGACLESDDMATCLAVKGITALNRAA 66

  Fly    42 RNLNRSDKPLVVIRGLEI-------VPLQNNSISDEE--------PDQEQGLL-----DSLSFYL 86
            |:.|     :.:..|:..       |.....|:|:::        .|:..|.|     .|.:.:|
  Fly    67 RSNN-----IELASGVTFQRDPASPVSRTGKSMSEQDVYAELPQNADERTGRLVDLAVSSAADFL 126

  Fly    87 RTHEINVKLADLLEDESQVSEARKKDKGQG----MLLAMALMFG-KMMAV--MGLGGIAALAMKA 144
            .||.:..||.  .|...||  ||..|:|:|    ||..:||..| |:.||  :.||.:|.|..||
  Fly   127 STHNLEFKLP--AETTQQV--ARALDEGRGKIKKMLGPVALAIGAKLFAVIPLVLGFLALLTFKA 187

  Fly   145 LGVSLVALMMAGMLG-------------------------LKTAAQHGGESSHSISY-----VTG 179
            :.|:.:|..:|.::|                         ....|..|..|..|.||     ::.
  Fly   188 VIVAKLAFFLAILVGGSRLLGGFGNKFGGNSFAGAYNSNAWSAPASAGWSSGASSSYPYARSISE 252

  Fly   180 EGHHHKRRRRSSGQQPLAYRG 200
            :|         |..|.|||.|
  Fly   253 DG---------SDAQQLAYAG 264

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi5NP_649624.1 DUF1676 <55..121 CDD:285181 23/90 (26%)
RCR 184..>201 CDD:304939 6/18 (33%)
Osi14NP_649635.1 DUF1676 62..160 CDD:285181 26/107 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.