DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi5 and Osi13

Sequence 1:NP_649624.1 Gene:Osi5 FlyBaseID:FBgn0037413 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_649634.1 Gene:Osi13 FlyBaseID:FBgn0037422 Length:210 Species:Drosophila melanogaster

Alignment Length:170 Identity:37/171 (22%)
Similarity:68/171 (40%) Gaps:47/171 (27%)


  Fly    50 PLVVIRGLEIVPLQNNSISDEEPDQEQG----------------LLDSLSFYLRTHEINVKLADL 98
            |:|.:.|..:..::.::..:...::.|.                :.|.||    |.|:|    ::
  Fly    27 PVVQMGGAIVAAVEQDAEQEAAAEERQRVERHWLSMAETQLHSLITDDLS----TEEVN----NM 83

  Fly    99 LEDESQVSEARKKDKGQGMLLAM------ALMFGKMMAV-MGLGGIAALAMKALGVSLVALMMAG 156
            ||..|  :|.|.|.|.|..|:.|      |:...|::.: :.|..:.||:..:..:..:||:.:|
  Fly    84 LETWS--TEGRGKHKKQKKLMKMVYPLLAAVAVAKVVLLPLILKWLTALSTSSFVMGKIALVTSG 146

  Fly   157 MLGLKTAAQHGGESSHSISYVTGEGHHHKRRRRSSGQQPL 196
            :|.||              ::...||.|.|........||
  Fly   147 ILALK--------------WILSGGHAHDRLEIIHSHAPL 172

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi5NP_649624.1 DUF1676 <55..121 CDD:285181 17/82 (21%)
RCR 184..>201 CDD:304939 4/14 (29%)
Osi13NP_649634.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C124145120
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.