DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi5 and Osi10

Sequence 1:NP_649624.1 Gene:Osi5 FlyBaseID:FBgn0037413 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_731058.1 Gene:Osi10 FlyBaseID:FBgn0037417 Length:576 Species:Drosophila melanogaster

Alignment Length:169 Identity:39/170 (23%)
Similarity:71/170 (42%) Gaps:28/170 (16%)


  Fly    31 CRGERALRNVLRNLNRSDKPLVVIRGLEIVPLQNNSISDEEPD---QEQGLLDSLSFYLRTHEIN 92
            |.|..: ..:|....|.:....:...|.|.|    .:...:|:   .:.||...|...::...:.
  Fly   348 CLGSES-EQLLDGATRDNSTWQITDYLSIEP----KVGISKPETRRMDMGLPGKLLELVQGRALR 407

  Fly    93 VKL------ADLLED---ESQVSEARK---KDKGQGMLLAMALMFGKMMAVMGLGGIAALAMKAL 145
            ::|      ::.::|   |..:.:.||   |||...|:..|.:|  ..:|.|.||.:..:|..|.
  Fly   408 LQLPRQLTISNAIDDFGSELGLDQGRKKKDKDKNMAMMGGMIMM--ATLAQMFLGKVILIAGSAF 470

  Fly   146 GVSLVALMMAGMLGLKTAAQHGGESSHSISYVTGEGHHH 184
            .::.:||:::.:..||.     |.:.||.| ..|.|..|
  Fly   471 IMAKIALVISLLGSLKK-----GSTGHSGS-GGGSGTEH 503

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi5NP_649624.1 DUF1676 <55..121 CDD:285181 16/81 (20%)
RCR 184..>201 CDD:304939 1/2 (50%)
Osi10NP_731058.1 DUF1676 42..203 CDD:311725
DUF1676 355..487 CDD:311725 30/138 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C124145133
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.