DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi5 and Osi9

Sequence 1:NP_649624.1 Gene:Osi5 FlyBaseID:FBgn0037413 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_649628.2 Gene:Osi9 FlyBaseID:FBgn0037416 Length:233 Species:Drosophila melanogaster

Alignment Length:246 Identity:55/247 (22%)
Similarity:100/247 (40%) Gaps:60/247 (24%)


  Fly     1 MFRTFPLLCLLFLTAVRSENCD----------QDAG--ATLYCRGERALR--------------- 38
            ||:...|..|:..||..:...|          :|.|  :.:.|..||||.               
  Fly     1 MFKFVCLFALIASTAAATSEADSLLTSALKMVKDCGERSMVLCMKERALHYFDAENGDVRLTEGI 65

  Fly    39 --------NVLRNLNRSDKPLVVIRGLEIVPLQNNSISDEEPDQEQGLLDSLSFYLRTHEINVKL 95
                    .|.|:||....|              ..:...|.:.:..|::.::.:..||.:..|:
  Fly    66 ALVKTDEIPVGRSLNEMQLP--------------EEVEAREAEVDSLLVERVARFFGTHTLQFKV 116

  Fly    96 -ADLLEDESQV---SEARKKDKGQGMLLAMALMFGKMMAV--MGLGGIAALAMKALGVSLVALMM 154
             .|.::|..:.   |..:||:|.:.::..:.|...||.|:  :.:|.:|.::.|||.:..:||::
  Fly   117 PKDSIQDMQRALEESRGKKKEKKKYLMPLLMLFKLKMAALLPLAIGFLALISFKALVIGKIALLL 181

  Fly   155 AGMLGLKTAAQHGGESSHSISYVTGEGHHHKRRRR----SSGQQPLAYRGW 201
            :|::|||...:...|:...:::...| |.|...|.    .|..|.|||..:
  Fly   182 SGIIGLKKLLESKKENYEVVAHPHYE-HEHSYGRSLPSDDSQAQQLAYAAY 231

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi5NP_649624.1 DUF1676 <55..121 CDD:285181 11/70 (16%)
RCR 184..>201 CDD:304939 7/21 (33%)
Osi9NP_649628.2 DUF1676 54..144 CDD:285181 16/104 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.