DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi5 and Osi8

Sequence 1:NP_649624.1 Gene:Osi5 FlyBaseID:FBgn0037413 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_649627.1 Gene:Osi8 FlyBaseID:FBgn0037415 Length:274 Species:Drosophila melanogaster

Alignment Length:228 Identity:61/229 (27%)
Similarity:99/229 (43%) Gaps:55/229 (24%)


  Fly    19 ENCDQDAGAT-----------LY--CRGER-------ALRNVLRNLNRSDKPLVVIRGLEIV--- 60
            :|.:...|:|           :|  |.|:.       .|...|....||.|.|.::.|::.|   
  Fly    43 QNSNPGMGSTGLWKDMSMVYRIYQQCSGDNMSVCLKVKLLTGLEKAFRSAKSLSLMEGIQFVSSG 107

  Fly    61 ---------PLQNNSISDEEP---DQEQGLLDSLSF-----YLRTHEINVKLADLLEDESQVSEA 108
                     |:....|....|   |.::.:|:::..     :|:.|.:.||    .::|:...|.
  Fly   108 GESEETKRAPISEKDIEAVLPRSVDAKEQVLNNMILKRVGNFLQDHTLQVK----FDNEANSVEG 168

  Fly   109 RKK--DKGQGMLLAMALMFGKMMAVMGLGGIAALAMKALGVSLVALMMAGMLGLKTAAQHGG--- 168
            |||  .||.|.::.:.|:.|..:..:..|.:|.||.|||.||.:||::|.::|:|.....||   
  Fly   169 RKKKEKKGNGAMIMIPLLLGGTIVPLAYGALAMLAGKALIVSKLALVLASIIGIKKLLSGGGGGK 233

  Fly   169 ESSHSISYVTGEGHHHKRRRRSSGQQPLAYRGW 201
            ||||.: .|:..||....|...:     ||.||
  Fly   234 ESSHEV-VVSSGGHSGWGRELDT-----AYSGW 260

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi5NP_649624.1 DUF1676 <55..121 CDD:285181 19/88 (22%)
RCR 184..>201 CDD:304939 4/17 (24%)
Osi8NP_649627.1 DUF1676 85..>169 CDD:285181 18/88 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C124145129
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.