DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi5 and Osi6

DIOPT Version :9

Sequence 1:NP_649624.1 Gene:Osi5 / 40759 FlyBaseID:FBgn0037413 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_001287192.1 Gene:Osi6 / 40760 FlyBaseID:FBgn0027527 Length:312 Species:Drosophila melanogaster


Alignment Length:264 Identity:60/264 - (22%)
Similarity:92/264 - (34%) Gaps:79/264 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CLLFLTAVRSEN----CDQDAGATLYCRGERALRNVLRNLNRS-----DKPLV-VIRGLEIV--- 60
            |:|.|.|..|.:    .::..||...|....::..:...|.|.     |.|.: :..|:.:|   
  Fly    35 CILLLAAGISADPVKAAEEQPGAFAQCLESDSISCLQLTLFRKAKSVFDNPQIELFGGVSLVKSN 99

  Fly    61 ------PLQNNSISDEEP-----DQEQG--LLDSLSFYLRTHEINVKLA------------DLLE 100
                  .|.|:...:..|     ..|.|  .:|:...:.....:|...|            |:..
  Fly   100 EGRQGKSLDNSLAVEAAPTVEARTAEMGNYFMDNAKSFFAERSLNFNFANAARSVARAIPDDIKA 164

  Fly   101 D--ESQVSEARKKDKGQGMLLAMALMFGKMMAVMGLG---GIAALAMKALGVSLVALMMA----- 155
            |  |..|....:|.|.....|.:.|..|..:||:|:|   |:..||.|||.||::|..:|     
  Fly   165 DLRELVVESRTRKKKLLKKFLPILLGVGAKIAVLGVGSIFGLLFLAKKALVVSVIAFFLALAAGA 229

  Fly   156 ---------------------GMLGLKTAAQHGGESSHSI-SYVTGEGHHHKRRRRSSGQQPLAY 198
                                 |:.|.|.|   ||.|:.|. .:.:|.|      ..|:|......
  Fly   230 SSGLGRIGGSGGGGGLLGGLGGLFGGKNA---GGSSAASTGGWSSGGG------ASSAGWSSGGS 285

  Fly   199 RGWD 202
            .|||
  Fly   286 SGWD 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi5NP_649624.1 DUF1676 <55..121 CDD:285181 17/95 (18%)
RCR 184..>201 CDD:304939 2/16 (13%)
Osi6NP_001287192.1 DUF1676 81..176 CDD:285181 16/94 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.