DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi5 and Osi4

Sequence 1:NP_649624.1 Gene:Osi5 FlyBaseID:FBgn0037413 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_001262305.1 Gene:Osi4 FlyBaseID:FBgn0037412 Length:395 Species:Drosophila melanogaster

Alignment Length:149 Identity:35/150 (23%)
Similarity:52/150 (35%) Gaps:62/150 (41%)


  Fly   111 KDKGQ-GMLLAM---ALMFG-KMMAVMGLGGIAALAMKALGVSLVALMMAGMLGLK----TAAQ- 165
            :||.| .|.:.|   |..|| .|:|...:|   .|.:|||.:|.:|.::|.::.:|    .|:: 
  Fly   208 QDKKQFQMFIPMYLAATTFGWTMVAAKAVG---LLTLKALILSKIAFVVAAIVLIKKLMDNASEK 269

  Fly   166 ---------------------HGGE--------SSHSISYVTG-----------------EGHHH 184
                                 ||.|        |.|.::...|                 |.|.|
  Fly   270 MMYQFPEQTPYMMPYGMDYPLHGAEISPEMYPSSLHHLAMAGGGQLPGHPGHPGLESLSAESHLH 334

  Fly   185 KRRRRSSGQ---QPLAYRG 200
            ..:..|.|.   |.||..|
  Fly   335 SAQVSSDGSNNTQVLAALG 353

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi5NP_649624.1 DUF1676 <55..121 CDD:285181 4/11 (36%)
RCR 184..>201 CDD:304939 7/21 (33%)
Osi4NP_001262305.1 DUF1676 <210..261 CDD:311725 18/54 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.