powered by:
                   
 
    
    
             
          
            Protein Alignment Osi5 and Osi2
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_649624.1 | Gene: | Osi5 / 40759 | FlyBaseID: | FBgn0037413 | Length: | 202 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | NP_001262303.1 | Gene: | Osi2 / 40756 | FlyBaseID: | FBgn0037410 | Length: | 390 | Species: | Drosophila melanogaster | 
        
        
        
          
            | Alignment Length: | 125 | Identity: | 31/125 - (24%) | 
          
            | Similarity: | 49/125 -  (39%) | Gaps: | 24/125 - (19%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly    97 DLLEDESQVSE-ARKKDKGQGMLLAMALMFGKMMAVMGLG---GIAALAMKALGVSLVALM---- 153||::|..:... :|||.|...:.|.:.|...|:..::.|.   |||.| .|.||::.:.|.
 Fly   202 DLIDDGQRAGHFSRKKLKKMIIPLLLVLKIFKLKLLLFLPFILGIAGL-KKILGLAAIVLPGLFA 265
 
 
  Fly   154 ----------MAGMLGLKTAAQHGGESSHSISYVTGEG-----HHHKRRRRSSGQQPLAY 198:.|..|...:...||:::.......|.|     |||:......|..|..|
 Fly   266 YFKLCRPPGGVGGAFGGGLSGLFGGKNTFPEYNPQGVGAATYYHHHEHFEGGHGGAPGPY 325
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 0 | 0.000 | Not matched by this tool. | 
          
            | Domainoid | 0 | 0.000 | Not matched by this tool. | 
          
            | eggNOG | 0 | 0.000 | Not matched by this tool. | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Isobase | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoDB | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoFinder | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoInspector | 0 | 0.000 | Not matched by this tool. | 
          
            | orthoMCL | 0 | 0.000 | Not matched by this tool. | 
          
            | Panther | 1 | 1.100 | - | - | P | PTHR21879 | 
          
            | Phylome | 0 | 0.000 | Not matched by this tool. | 
          
            | RoundUp | 0 | 0.000 | Not matched by this tool. | 
          
            | SonicParanoid | 0 | 0.000 | Not matched by this tool. | 
          
            |  | 1 | 1.100 |  | 
        
      
           
             Return to query results.
             Submit another query.