DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi5 and Osi21

Sequence 1:NP_649624.1 Gene:Osi5 FlyBaseID:FBgn0037413 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_609501.1 Gene:Osi21 FlyBaseID:FBgn0283678 Length:282 Species:Drosophila melanogaster

Alignment Length:193 Identity:51/194 (26%)
Similarity:87/194 (45%) Gaps:37/194 (19%)


  Fly    19 ENCDQDAGATLYCRGERALRNVLRNLNRSDKPLVVIRGLEIVPLQNNSISDE------EPDQ--- 74
            ::| ||....:.|..::||..:.|.|::..  :.::.||.: ..||.|.::.      :..|   
  Fly    59 DDC-QDKNDFIGCLKQKALHALSRALDQDS--IKIVDGLAL-EKQNQSETESILGSLTDARQFGN 119

  Fly    75 ----EQGLLDSLSFYLRTHEINVKLADLLEDESQV----SEARKKDKGQG--------MLLAMAL 123
                ::.||......:|||.:.:.: |:...|..|    ...:||.|..|        :|.||.:
  Fly   120 LSPIDRALLSKADKLMRTHTLKIDM-DVGGGEDSVGREHGHKKKKHKEGGHIKYVVAALLTAMGI 183

  Fly   124 MFGKMMAVMGLGGIAALAMKALGVSLVALMMAGMLGLKTAAQHGGESSHSISYVTGEGHHHKR 186
                 ...:||..:||:|.|||.:|.|||.:||::.||....|  :.|...|:....|.|::|
  Fly   184 -----AGPLGLKALAAIAGKALVISKVALTIAGIIALKKLFSH--DHSEETSFQVHAGEHNRR 239

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi5NP_649624.1 DUF1676 <55..121 CDD:285181 20/91 (22%)
RCR 184..>201 CDD:304939 1/4 (25%)
Osi21NP_609501.1 DUF1676 79..>152 CDD:285181 15/77 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.