powered by:
                  
 
    
 
    
             
          
            Protein Alignment Osi5 and Osi16
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_649624.1 | 
            Gene: | Osi5 / 40759 | 
            FlyBaseID: | FBgn0037413 | 
            Length: | 202 | 
            Species: | Drosophila melanogaster | 
          
          
            | Sequence 2: | NP_731065.1 | 
            Gene: | Osi16 / 318801 | 
            FlyBaseID: | FBgn0051561 | 
            Length: | 278 | 
            Species: | Drosophila melanogaster | 
          
        
        
        
          
            | Alignment Length: | 176 | 
            Identity: | 55/176 - (31%) | 
          
          
            | Similarity: | 82/176 -  (46%) | 
            Gaps: | 39/176 - (22%) | 
          
        
      
- Green bases have known domain annotations that are detailed below.
      | 
 
  Fly    51 LVVIRGLEIVPLQN--------------NSISDEEPDQEQG-LLDSLSFYLRTHEINVKLADLLE 100 
            |.|:.|:.:|..:|              .|...:...:..| ::..|...|||..:..:   ||: 
  Fly    81 LNVLPGISVVKDENATELKTSELMAEVARSYPSDPSTRLNGYIVAKLENLLRTRFLRFR---LLD 142 
 
  Fly   101 DESQVSEARK----KDKGQGMLLAMALMFGKMMAVMGLGGIAALAMKALGVSLVALMMAGMLGLK 161 
            |:|.| |.||    |..|...|:|..:|...|:..||||.||.:|.|||..:|:||.::|:|||| 
  Fly   143 DKSLV-EGRKHKFGKKGGLEALVAAGVMMKGMLMAMGLGAIALMAGKALMTALMALTLSGVLGLK 206 
 
  Fly   162 TAAQHGGES---------------SHSISYVTGEGHHHKRRRRSSG 192 
            :.|..||:|               |||:::..| ||.|.....:.| 
  Fly   207 SLAGGGGKSTTYEIVAKPIYTSSHSHSVTHEDG-GHSHSPHFAAGG 251 
 
       | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | 
            Simple Score | 
            Weighted Score | 
            Original Tool Information | 
          
          
            | BLAST Result | 
            Score | 
            Score Type | 
            Cluster ID | 
          
          
          
            | Compara | 
            1 | 
            0.930 | 
            - | 
            - | 
             | 
            C45442623 | 
          
          
            | Domainoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | eggNOG | 
            1 | 
            0.900 | 
            - | 
            - | 
             | 
            E1_2AHF7 | 
          
          
            | Homologene | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Inparanoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Isobase | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OMA | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoDB | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoFinder | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoInspector | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | orthoMCL | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Panther | 
            1 | 
            1.100 | 
            - | 
            - | 
            P | 
            PTHR21879 | 
          
          
            | Phylome | 
            1 | 
            0.910 | 
            - | 
            - | 
             | 
             | 
          
          
            | RoundUp | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | SonicParanoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
             | 
            4 | 3.840 | 
             | 
          
        
      
           
             Return to query results.
             Submit another query.