DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Osi5 and Osi16

Sequence 1:NP_649624.1 Gene:Osi5 FlyBaseID:FBgn0037413 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_731065.1 Gene:Osi16 FlyBaseID:FBgn0051561 Length:278 Species:Drosophila melanogaster

Alignment Length:176 Identity:55/177 (31%)
Similarity:82/177 (46%) Gaps:39/177 (22%)


  Fly    51 LVVIRGLEIVPLQN--------------NSISDEEPDQEQG-LLDSLSFYLRTHEINVKLADLLE 100
            |.|:.|:.:|..:|              .|...:...:..| ::..|...|||..:..:   ||:
  Fly    81 LNVLPGISVVKDENATELKTSELMAEVARSYPSDPSTRLNGYIVAKLENLLRTRFLRFR---LLD 142

  Fly   101 DESQVSEARK----KDKGQGMLLAMALMFGKMMAVMGLGGIAALAMKALGVSLVALMMAGMLGLK 161
            |:|.| |.||    |..|...|:|..:|...|:..||||.||.:|.|||..:|:||.::|:||||
  Fly   143 DKSLV-EGRKHKFGKKGGLEALVAAGVMMKGMLMAMGLGAIALMAGKALMTALMALTLSGVLGLK 206

  Fly   162 TAAQHGGES---------------SHSISYVTGEGHHHKRRRRSSG 192
            :.|..||:|               |||:::..| ||.|.....:.|
  Fly   207 SLAGGGGKSTTYEIVAKPIYTSSHSHSVTHEDG-GHSHSPHFAAGG 251

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Osi5NP_649624.1 DUF1676 <55..121 CDD:285181 21/85 (25%)
RCR 184..>201 CDD:304939 2/10 (20%)
Osi16NP_731065.1 DUF1676 72..156 CDD:285181 19/79 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C140925278
eggNOG 1 0.900 E1_2AHF7
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21879
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.