DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gasp and CG7017

Sequence 1:NP_649611.2 Gene:Gasp FlyBaseID:FBgn0026077 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001262095.1 Gene:CG7017 FlyBaseID:FBgn0036951 Length:359 Species:Drosophila melanogaster

Alignment Length:194 Identity:46/195 (24%)
Similarity:65/195 (33%) Gaps:54/195 (28%)


  Fly    18 QSSFKCPDDFGFYPHDTSC--DKYWKCDNGVSELKTCGNGLAFDATDSKYLTENCDYLHNVDCGD 80
            |....||::..|:|...||  :|.::|                ..:.:|..:..|..|.|     
  Fly   131 QIKANCPNELIFHPVSRSCVYEKQYRC----------------PISQTKKTSPACRSLPN----- 174

  Fly    81 RTELEPPITTPHCSRLYGIFPDENKCDVFWNCWNGEPSRYQCSPGLAYDRDARVCMWADQVPECK 145
            .|.|..|:                .||.::.|.:.......|....|||.:...|:...:| .|.
  Fly   175 NTRLADPV----------------HCDQYYECVSEVLHSRACPVASAYDANLGYCVDVAEV-SCY 222

  Fly   146 NE----EVANGFSCPAAGELANAGSFSRHAHPEDCRKYYICLEGVA-------REYGCPIGTVF 198
            ..    |..|.|...:|...|..|.|   |..|.|..||||...||       :...||:|..|
  Fly   223 ESAALPEPENTFCLDSATGSARVGYF---ADDESCSHYYICGSPVAGKHDTEPKHLSCPLGQYF 283

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GaspNP_649611.2 ChtBD2 21..72 CDD:214696 10/53 (19%)
CBM_14 98..144 CDD:279884 9/46 (20%)
CBM_14 170..218 CDD:279884 13/37 (35%)
CG7017NP_001262095.1 CBM_14 103..155 CDD:279884 8/24 (33%)
ChtBD2 246..290 CDD:214696 15/42 (36%)
CBM_14 303..348 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C50916
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23301
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.