DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gasp and obst-F

Sequence 1:NP_649611.2 Gene:Gasp FlyBaseID:FBgn0026077 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_649186.1 Gene:obst-F FlyBaseID:FBgn0036947 Length:326 Species:Drosophila melanogaster

Alignment Length:293 Identity:66/294 (22%)
Similarity:91/294 (31%) Gaps:132/294 (45%)


  Fly    31 PHDTSCDKYWKCDNGVSELKTCGNGLAFDATDSKYLTEN---CDYLHNVDC-------------- 78
            ||...|:.|:.|.. |..|..|..||.||        ||   ||...|.:|              
  Fly    53 PHPLDCNGYFSCSR-VPTLLYCDQGLQFD--------ENRAICDLPENTNCRPVATGTVESANGL 108

  Fly    79 GDRTELEPPITTPH-----------------------------CSRLYGIF--PDENKCDVFWNC 112
            .|.:||.   ..||                             | |.||.:  |....|.:::.|
  Fly   109 ADNSELN---WWPHKPKPVFVAVDVTSGQPVNPMEKYDPEHIEC-RHYGAYFLPHPRNCGLYFIC 169

  Fly   113 WNGEPSRYQCSPGLAYDRDARVCMWADQ---------------------VPECKNE--------- 147
            ..|...|:||..|.|::.:...|..:||                     ||...:|         
  Fly   170 AYGHLHRHQCGRGTAWNFEKSECQLSDQAICYGESQISEPHTDVETTMKVPTANSEGAVTVCYIV 234

  Fly   148 ---------------EV---------------ANGFSCPAAGELANAGSFSRHAHPEDCRKYYIC 182
                           |:               ||..:||:..:       |..:|||||.|||||
  Fly   235 GSSEYTTLQQFLTSPEITELPPVTPPSPPRAEANALTCPSTKQ-------SYMSHPEDCSKYYIC 292

  Fly   183 LEGVAREYGCPIGTVFKIGDSDGTGNCEDPEDV 215
            :.|:.....||.|..:    ...:|.||..::|
  Fly   293 IGGMPVLTSCPKGLFW----DQKSGFCEMEKNV 321

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GaspNP_649611.2 ChtBD2 21..72 CDD:214696 16/44 (36%)
CBM_14 98..144 CDD:279884 15/69 (22%)
CBM_14 170..218 CDD:279884 18/47 (38%)
obst-FNP_649186.1 CBM_14 43..94 CDD:279884 17/50 (34%)
CBM_14 156..198 CDD:279884 12/42 (29%)
CBM_14 272..321 CDD:279884 20/60 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C50073
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23301
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.