DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gasp and obst-G

Sequence 1:NP_649611.2 Gene:Gasp FlyBaseID:FBgn0026077 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_648529.1 Gene:obst-G FlyBaseID:FBgn0036228 Length:279 Species:Drosophila melanogaster

Alignment Length:290 Identity:72/291 (25%)
Similarity:109/291 (37%) Gaps:71/291 (24%)


  Fly     1 MKKFLVVFVALF----GAAVAQSSFKCPDDF------GFYPHDTSCDKYWKCDNGVSELKTCGNG 55
            ||.|.::.|.|.    ..||.|:.|......      |..|...||..|:.|.:|.:...||...
  Fly     1 MKLFGLLCVMLVLQESTLAVVQNGFAFKTSLCEGKNGGLLPMFGSCKGYYVCADGNAVTGTCEKN 65

  Fly    56 LAFDATDSKYLTENCDYLHNVDC-------------------GDRTEL---EPPITT-----PHC 93
            ..|:.     ||.:||...||||                   .|..|:   :||:|.     |..
  Fly    66 TLFNP-----LTLHCDDPDNVDCIFDGKDNIVDDTSSSESDEDDDEEMAKTDPPVTVKATKKPRP 125

  Fly    94 SRL--------YGIFPDEN-KCDVFWNCWNGEPSRYQCSPGLAYDRDARVCMWADQVPEC----- 144
            :.|        .|:...:| .|..::.|...:|....|.....:....|:||.|.:. :|     
  Fly   126 TTLDKMCAGKKDGVMLTKNGSCQEYYVCKAKKPHLRSCPDKQHFSPTRRICMKASEA-KCSGGTR 189

  Fly   145 KNEEVANGFSCPA--AGELANAGSFSRHAHPEDCRKYYICLEGVAREYGCPIGTVFKIGDSDGTG 207
            :|:| ::|   ||  .|..::....|..||..||.|:.:|...:.....||.|..|.|    .|.
  Fly   190 ENKE-SDG---PATTGGVCSDEKENSLVAHRSDCGKFMLCSNMMFLVMDCPTGLHFNI----ATS 246

  Fly   208 NCEDPEDVPGCEDYYGDLDLKS---IRKSE 234
            .|:.|: :..|:....:...||   :|||:
  Fly   247 RCDYPK-IAKCQTKLNESKSKSKKPVRKSK 275

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GaspNP_649611.2 ChtBD2 21..72 CDD:214696 15/57 (26%)
CBM_14 98..144 CDD:279884 10/47 (21%)
CBM_14 170..218 CDD:279884 14/48 (29%)
obst-GNP_648529.1 CBM_14 32..83 CDD:279884 17/56 (30%)
CBM_14 132..184 CDD:279884 10/53 (19%)
CBM_14 204..256 CDD:279884 15/57 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C50788
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23301
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.