DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gasp and CG17826

DIOPT Version :10

Sequence 1:NP_649611.2 Gene:Gasp / 40745 FlyBaseID:FBgn0026077 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_648528.1 Gene:CG17826 / 39354 FlyBaseID:FBgn0036227 Length:751 Species:Drosophila melanogaster


Alignment Length:198 Identity:53/198 - (26%)
Similarity:78/198 - (39%) Gaps:54/198 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PHDTSCDKYWKCDNGVSELKTCGNGLAFDAT--DSKYLTEN------CDYLHNVDCGDRTELEPP 87
            |.|  |..|.:|.|||...:.|.....|:.|  :.:..|||      ||    .||.|       
  Fly   571 PAD--CAGYLQCINGVFVARKCSATQFFNTTLKECEVDTENVCIPKTCD----PDCCD------- 622

  Fly    88 ITTPHCSRLYGIFPDENKCDVFWNCWNGEPSRYQCSPGLAYDRDARVCMWADQVPECKNEEVANG 152
              .|:.|    |:|.|..|..|:.|.||.....:||..|.|:.....|.:.:.| :|.:.     
  Fly   623 --VPNNS----IWPVEKNCSAFYQCVNGNKYEQRCSNNLQYNSIIEQCDYPENV-QCDDG----- 675

  Fly   153 FSCPAAGELAN-AGSFSRHAHPEDCRKYYICLEGVAREYGCPIGTVFKIGDSDGTGNCEDPEDVP 216
             |.|.:|.:|. :|::        |..:..|:       |...||:|    :|.:|:|.....|.
  Fly   676 -SAPPSGPIAGPSGTY--------CESHGRCV-------GQRDGTMF----ADASGDCSSNYVVC 720

  Fly   217 GCE 219
            .||
  Fly   721 QCE 723

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaspNP_649611.2 ChtBD2 21..72 CDD:214696 15/48 (31%)
CBM_14 97..144 CDD:426342 14/46 (30%)
CBM_14 170..218 CDD:426342 10/47 (21%)
CG17826NP_648528.1 CBM_14 36..74 CDD:426342
ChtBD2 <89..124 CDD:214696
CBM_14 145..184 CDD:426342
CBM_14 251..290 CDD:426342
CBM_14 357..396 CDD:426342
CBM_14 463..502 CDD:426342
CBM_14 563..610 CDD:426342 13/40 (33%)
CBM_14 621..670 CDD:426342 16/61 (26%)
CBM_14 697..749 CDD:426342 11/38 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.