DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gasp and CG31077

DIOPT Version :9

Sequence 1:NP_649611.2 Gene:Gasp / 40745 FlyBaseID:FBgn0026077 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_733185.2 Gene:CG31077 / 318583 FlyBaseID:FBgn0051077 Length:988 Species:Drosophila melanogaster


Alignment Length:237 Identity:59/237 - (24%)
Similarity:88/237 - (37%) Gaps:66/237 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FGAAVAQSSFKCPDDFGFYPHD-TSCDKYWKCDNGVSELKTCGNGLAFDATDSKYLTENCDYLHN 75
            || ::.:.|.||.:  |....| ..|..|::|.:..:....|.||..|:|::     |.|    .
  Fly    26 FG-SIIKDSVKCTE--GSVAADIDDCASYFQCIDDETVHLNCANGSYFEASN-----EIC----V 78

  Fly    76 VD----CGDRTELEPPITTPHCSRLY---GIFPDENKCDVFWNCWNGEPSRYQCSPGLAYDRDAR 133
            ||    |            |...||.   .||.|.|.|..:..|..|:..|.:|..|..::..::
  Fly    79 VDEFGVC------------PTSRRLCFDGDIFEDINDCMSYVKCIRGDLVRQRCPAGSNFNVISK 131

  Fly   134 VCMWADQVPECKNEEVANGFSCPAAGELANAGSFSRHAHPEDCRKYYICLEGVAREYGCPIGT-- 196
            .|            :::...||.:..|:...|..  ....|||..|..||.|...:..||||:  
  Fly   132 NC------------QMSRTGSCASPKEICLEGEL--QVDSEDCAGYLECLNGGLVKEKCPIGSYF 182

  Fly   197 --VFKIGDSDGTGNCE-------------DPEDVPG---CED 220
              :||:...|..|.|.             ||.:..|   ||:
  Fly   183 EPIFKLCQLDENGVCSSSSSECTDGEVRVDPNNCAGYFNCEN 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaspNP_649611.2 ChtBD2 21..72 CDD:214696 14/51 (27%)
CBM_14 97..144 CDD:366726 11/49 (22%)
CBM_14 170..218 CDD:366726 19/67 (28%)
CG31077NP_733185.2 CBM_14 43..81 CDD:279884 12/46 (26%)
ChtBD2 <212..245 CDD:214696 5/13 (38%)
CBM_14 267..308 CDD:279884
CBM_14 439..472 CDD:279884
CBM_14 733..769 CDD:279884
CBM_14 881..914 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443983
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.