DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gasp and Muc68E

DIOPT Version :10

Sequence 1:NP_649611.2 Gene:Gasp / 40745 FlyBaseID:FBgn0026077 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_996064.1 Gene:Muc68E / 2768990 FlyBaseID:FBgn0053265 Length:1799 Species:Drosophila melanogaster


Alignment Length:191 Identity:50/191 - (26%)
Similarity:71/191 - (37%) Gaps:42/191 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 CPDDFGFYPHDTSCDKYWKCDNGVSELKTCGNGLAFD------ATDSKYL---TENCDYLHNVDC 78
            |...:.:.||.|:|.||..|.||...:..|...|.:|      :.||...   |||.:....| |
  Fly  1626 CSTGYQYLPHPTNCHKYIHCSNGHELIMECPANLYWDYHKFVCSGDSGVCYNDTENSNPEEKV-C 1689

  Fly    79 GDRTELEPPITTPHCSRLYGIFPDENKCDVFWNCWNGEPSRYQCSPGLAYDRDARVCMWADQVPE 143
            |...:.   :..|            ..|.::..|.||.....:|...|.::.:.:.|.|:::.  
  Fly  1690 GPGVDF---LAHP------------TDCTMYLQCSNGVALERKCPDPLYWNPEIKSCDWSNKY-- 1737

  Fly   144 CKNEEVANGFSCPAAGELANAGSFSRHAHPEDCRKYYIC--LEGVARE-----YGCPIGTV 197
            |.|...:...|| |||  .|...|.     .||.||..|  |.||...     |..|:..|
  Fly  1738 CTNLRASQSISC-AAG--MNFNVFQ-----SDCSKYVKCFGLRGVVMSCNSGLYWNPVSQV 1790

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaspNP_649611.2 ChtBD2 21..72 CDD:214696 18/57 (32%)
CBM_14 97..144 CDD:426342 8/46 (17%)
CBM_14 170..218 CDD:426342 11/35 (31%)
Muc68ENP_996064.1 rne <158..303 CDD:236766
MDN1 300..1293 CDD:444083
rne <1358..1503 CDD:236766
ChtBD2 1626..1668 CDD:214696 13/41 (32%)
ChtBD2 1688..1734 CDD:214696 11/61 (18%)
ChtBD2 <1761..1791 CDD:214696 11/30 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.