DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp83b and Obp83cd

DIOPT Version :10

Sequence 1:NP_524242.2 Gene:Obp83b / 40738 FlyBaseID:FBgn0010403 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_649612.1 Gene:Obp83cd / 40746 FlyBaseID:FBgn0046878 Length:242 Species:Drosophila melanogaster


Alignment Length:112 Identity:26/112 - (23%)
Similarity:37/112 - (33%) Gaps:35/112 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GKHFHDICAPKTGVTDEAIKEFSDGQI---HEDEALKCYMNCLFHEFEVVDDNGDVHMEKVLNAI 95
            |:..::.|..|..:      .|..|:.   |..|...|..|...|.|.|:|:        :.|..
  Fly    93 GRPVYEACRKKLEL------PFESGESSCKHAYEGFHCITNMESHPFTVIDN--------MPNIS 143

  Fly    96 PGEKLRNIMMEASKGCIHPEGDTLCHKAWWFHQC-WKKADPVHYFLV 141
            |..|      :|.|.|:..           .||. ||..|...|:.|
  Fly   144 PSAK------DAMKDCLQD-----------VHQDEWKSFDAFAYYPV 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp83bNP_524242.2 PBP_GOBP 28..133 CDD:460193 23/102 (23%)
Obp83cdNP_649612.1 PhBP 30..129 CDD:214783 9/41 (22%)
PhBP 149..242 CDD:214783 10/36 (28%)

Return to query results.
Submit another query.