DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment glob3 and mb

DIOPT Version :9

Sequence 1:NP_649597.3 Gene:glob3 / 40726 FlyBaseID:FBgn0037385 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_001349318.1 Gene:mb / 393558 ZFINID:ZDB-GENE-040426-1430 Length:147 Species:Danio rerio


Alignment Length:125 Identity:24/125 - (19%)
Similarity:44/125 - (35%) Gaps:12/125 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 QAWNLVRPFERRYGQDVFYSFLNDYYWGIKKF------RNGAELNVKALHSHALRFINFFGLLIE 104
            :.|..|.......|.:|......:|...:|.|      ..|......|:.:|....:...|.|::
Zfish     9 KCWGAVEADYAANGGEVLNRLFKEYPDTLKLFPKFSGISQGDLAGSPAVAAHGATVLKKLGELLK 73

  Fly   105 EKDPVVFQLMINDNNHTHNRCHVGSVNIGHLAQALVDYVLKVF-HKVSSPSLEQGLSKLV 163
            .|..  ...::....:||...|..::|...|   :.:.::||. .|....:..||..:.|
Zfish    74 AKGD--HAALLKPLANTHANIHKVALNNFRL---ITEVLVKVMAEKAGLDAAGQGALRRV 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
glob3NP_649597.3 Mb_like 44..169 CDD:271266 24/125 (19%)
mbNP_001349318.1 Globin_like 2..147 CDD:328729 24/125 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.