DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment glob3 and cygb1

DIOPT Version :9

Sequence 1:NP_649597.3 Gene:glob3 / 40726 FlyBaseID:FBgn0037385 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_694484.1 Gene:cygb1 / 246090 ZFINID:ZDB-GENE-020513-1 Length:174 Species:Danio rerio


Alignment Length:130 Identity:29/130 - (22%)
Similarity:54/130 - (41%) Gaps:10/130 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LRQAWNLVRPFERRYGQDVFYSFLND------YYWGIKKFRNGAELNVKA-LHSHALRFINFFGL 101
            ::..|..|.......|..|...|..:      |:...::.::.||:...| |..|..|.:|....
Zfish    24 IQDTWKPVYAERDNAGVAVLVRFFTNFPSAKQYFEHFRELQDPAEMQQNAQLKKHGQRVLNALNT 88

  Fly   102 LIEE-KDPVVFQLMINDNNHTHNRCH-VGSVNIGHLAQALVDYVLKVFHKVSSPS-LEQGLSKLV 163
            |:|. :|......:.|....:|...| |..|....||..:::.:::.|.:..||: ::...|||:
Zfish    89 LVENLRDADKLNTIFNQMGKSHALRHKVDPVYFKILAGVILEVLVEAFPQCFSPAEVQSSWSKLM 153

  Fly   164  163
            Zfish   154  153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
glob3NP_649597.3 Mb_like 44..169 CDD:271266 29/130 (22%)
cygb1NP_694484.1 Globin 14..165 29/130 (22%)
Cygb 16..169 CDD:271275 29/130 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.