DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec20 and Bnip1

DIOPT Version :9

Sequence 1:NP_001287187.1 Gene:Sec20 / 40724 FlyBaseID:FBgn0037383 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_742161.4 Gene:Bnip1 / 224630 MGIID:109328 Length:228 Species:Mus musculus


Alignment Length:219 Identity:80/219 - (36%)
Similarity:130/219 - (59%) Gaps:11/219 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 QDLIDNNLQAKAIIHDILNSRTSIAELEELNEAGRSKLSAIRKSIERLDDWAR----DTADSALA 73
            |:::..:|:.||:|.||.:....::||.|||...:.|...:::.|:.|:..||    ::....|.
Mouse    14 QEIVKFDLEVKALIQDIRDCSGPLSELTELNTKVKEKFQQLKQRIQELEQSAREQDKESEKQLLL 78

  Fly    74 NEVDDHRDQFSKTLQAFRKANVSTMLEIEKANREELMAITGESELRQRTTTRARHNQGSLVSQEN 138
            .||::|:.|......::||||::..|.|:...:.||  :.|...||||.||:.     ||....:
Mouse    79 QEVENHKKQMLSNQTSWRKANLTCKLAIDNLEKAEL--LQGGDSLRQRKTTKE-----SLAQTSS 136

  Fly   139 DVTEKMLAISRHLSETTQKSAITLETLVASSQNVEATSDELHHTAGSISMSGKLLKKYGRRECTD 203
            .:||.::.|||.:|:..|:|...::|||:||:.:...::|....:|:|.:..||:.||.|||.||
Mouse   137 SITESLMGISRMMSQQVQQSEEAMQTLVSSSRTLLDANEEFKSMSGTIQLGRKLITKYNRRELTD 201

  Fly   204 KMLLFFAFSLFLACVFYIVQKRLF 227
            |:|:|.|.:||||.|.|||:||||
Mouse   202 KLLIFLALALFLATVLYIVKKRLF 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec20NP_001287187.1 Sec20 135..226 CDD:112708 38/90 (42%)
Bnip1NP_742161.4 SNARE_SEC20 132..224 CDD:277218 38/91 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850732
Domainoid 1 1.000 83 1.000 Domainoid score I8374
eggNOG 1 0.900 - - E1_28N8I
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H930
Inparanoid 1 1.050 141 1.000 Inparanoid score I4477
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55915
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004333
OrthoInspector 1 1.000 - - oto95399
orthoMCL 1 0.900 - - OOG6_103788
Panther 1 1.100 - - LDO PTHR12825
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3048
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.