DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2023 and Bnip1

Sequence 1:NP_001287187.1 Gene:CG2023 FlyBaseID:FBgn0037383 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_742161.4 Gene:Bnip1 MGIID:109328 Length:228 Species:Mus musculus

Alignment Length:219 Identity:80/220 (36%)
Similarity:130/220 (59%) Gaps:11/220 (5%)


  Fly    13 QDLIDNNLQAKAIIHDILNSRTSIAELEELNEAGRSKLSAIRKSIERLDDWAR----DTADSALA 73
            |:::..:|:.||:|.||.:....::||.|||...:.|...:::.|:.|:..||    ::....|.
Mouse    14 QEIVKFDLEVKALIQDIRDCSGPLSELTELNTKVKEKFQQLKQRIQELEQSAREQDKESEKQLLL 78

  Fly    74 NEVDDHRDQFSKTLQAFRKANVSTMLEIEKANREELMAITGESELRQRTTTRARHNQGSLVSQEN 138
            .||::|:.|......::||||::..|.|:...:.||  :.|...||||.||:.     ||....:
Mouse    79 QEVENHKKQMLSNQTSWRKANLTCKLAIDNLEKAEL--LQGGDSLRQRKTTKE-----SLAQTSS 136

  Fly   139 DVTEKMLAISRHLSETTQKSAITLETLVASSQNVEATSDELHHTAGSISMSGKLLKKYGRRECTD 203
            .:||.::.|||.:|:..|:|...::|||:||:.:...::|....:|:|.:..||:.||.|||.||
Mouse   137 SITESLMGISRMMSQQVQQSEEAMQTLVSSSRTLLDANEEFKSMSGTIQLGRKLITKYNRRELTD 201

  Fly   204 KMLLFFAFSLFLACVFYIVQKRLF 227
            |:|:|.|.:||||.|.|||:||||
Mouse   202 KLLIFLALALFLATVLYIVKKRLF 225

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2023NP_001287187.1 Sec20 135..226 CDD:112708 39/91 (43%)
Bnip1NP_742161.4 SNARE_SEC20 132..224 CDD:277218 39/92 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C218667071
eggNOG 1 0.900 E1_28N8I
Hieranoid 1 1.000
Homologene 1 1.000 H930
Inparanoid 1 1.050 141 1.000 Inparanoid score I4446
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004791
OrthoInspector 1 1.000 T1084640
orthoMCL 1 0.900 OOG5_131109
Panther 1 1.100 LDO PTHR12825
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3048
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.