DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11000 and Plekhb1

Sequence 1:NP_001097690.1 Gene:CG11000 FlyBaseID:FBgn0263353 Length:332 Species:Drosophila melanogaster
Sequence 2:XP_006229849.1 Gene:Plekhb1 RGDID:621614 Length:242 Species:Rattus norvegicus

Alignment Length:282 Identity:55/283 (19%)
Similarity:103/283 (36%) Gaps:74/283 (26%)


  Fly    15 PDSSFMQQSQQMQMQLQQPQAMGTGGKQIKGGYLLRYKKQMFWNRWAEEWVVLYDDSTMAWFTEP 79
            |||:.....::|.:              ::||:|  :::.....||...|..|:.|.|:.::.:.
  Rat     9 PDSTLESPFEEMAL--------------VRGGWL--WRQSSILRRWKRNWFALWLDGTLGYYHDE 57

  Fly    80 GRSSPTGKILVKEAPEMLAIAHW------TGQIPRRPPLPAGVNVSQLIALGSQRKRSKVYWMLA 138
            .......::::          |:      .||..:....|.|.:...|:.: :.|:.|::: :.|
  Rat    58 TAQDEEDRVVI----------HFNVRDIKVGQECQDVQPPEGRSRDGLLTV-NLREGSRLH-LCA 110

  Fly   139 KSEQEVSDWIDAI---TKTLPP-----PPQIELVVDKPHLMN-------VLRRPLVRIRPATQSE 188
            ::..:...|..|:   ..|..|     ||:...|..|....:       |.||..||:....|..
  Rat   111 ETRDDAIAWKTALMEANSTPAPAGATVPPRSRRVCPKVRCTSLSWKPCKVERRIWVRVYSPYQDY 175

  Fly   189 VKQRKAASHGASGSKHH---RCSSAISTKVYRQSQDPLVKSDAAVAILSKKPDSKASLACALPWG 250
            .:.....:|.|:..:.:   .....::..:.|  :||...|.|.:|:        ..||      
  Rat   176 YEVVPPNAHEATYVRSYYGPPYGPGVTHVIVR--EDPCYSSGAPLAM--------GMLA------ 224

  Fly   251 HGWGWATLPNGVWSGGLTWSQC 272
               |.||   |...|.|.||.|
  Rat   225 ---GAAT---GAALGSLMWSPC 240

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11000NP_001097690.1 PH 43..156 CDD:278594 21/122 (17%)
PH 43..155 CDD:214574 21/121 (17%)
Plekhb1XP_006229849.1 PH_evt 20..127 CDD:270085 21/135 (16%)
PH 22..126 CDD:278594 20/132 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR14309
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.