DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11000 and PLEKHB1

Sequence 1:NP_001097690.1 Gene:CG11000 FlyBaseID:FBgn0263353 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_067023.1 Gene:PLEKHB1 HGNCID:19079 Length:243 Species:Homo sapiens

Alignment Length:298 Identity:56/299 (19%)
Similarity:103/299 (34%) Gaps:105/299 (35%)


  Fly    15 PDSSFMQQSQQMQMQLQQPQAMGTGGKQIKGGYLLRYKKQMFWNRWAEEWVVLYDDSTMAWFTEP 79
            |||:.....::|.:              ::||:|  :::.....||...|..|:.|.|:.::.:.
Human     9 PDSALESPFEEMAL--------------VRGGWL--WRQSSILRRWKRNWFALWLDGTLGYYHDE 57

  Fly    80 GRSSPTGKIL-------VKEAPEMLAIAHWTGQIPRRPPLPAGVNVSQLIALGSQRKRSKVYWML 137
            .......::|       :|..||...:         :|  |.|.:...|:.: :.|:..::: :.
Human    58 TAQDEEDRVLIHFNVRDIKIGPECHDV---------QP--PEGRSRDGLLTV-NLREGGRLH-LC 109

  Fly   138 AKSEQEVSDWIDAITK----------TLPPPPQIELVVDKPHLMNVLRRPLVRIRPATQS----E 188
            |:::.:...|..|:.:          |:||..               ||...::|..|:|    :
Human   110 AETKDDALAWKTALLEANSTPAPAGATVPPRS---------------RRVCSKVRCVTRSWSPCK 159

  Fly   189 VKQRKAASHGASGSKHHRCSSAISTKVYRQSQD--PLVKSDA-----------------AVAILS 234
            |::|                  |..:||...||  .:|..:|                 .|..:.
Human   160 VERR------------------IWVRVYSPYQDYYEVVPPNAHEATYVRSYYGPPYAGPGVTHVI 206

  Fly   235 KKPDSKASLACALPWGHGWGWATLPNGVWSGGLTWSQC 272
            .:.|...|....|..|...|.||   |...|.|.||.|
Human   207 VREDPCYSAGAPLAMGMLAGAAT---GAALGSLMWSPC 241

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11000NP_001097690.1 PH 43..156 CDD:278594 22/130 (17%)
PH 43..155 CDD:214574 22/129 (17%)
PLEKHB1NP_067023.1 PH_evt 20..127 CDD:270085 22/136 (16%)
PH 22..126 CDD:278594 21/133 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR14309
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.