DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11000 and si:ch211-176g13.7

Sequence 1:NP_001097690.1 Gene:CG11000 FlyBaseID:FBgn0263353 Length:332 Species:Drosophila melanogaster
Sequence 2:XP_009303850.1 Gene:si:ch211-176g13.7 ZFINID:ZDB-GENE-030131-7664 Length:188 Species:Danio rerio

Alignment Length:192 Identity:37/193 (19%)
Similarity:57/193 (30%) Gaps:68/193 (35%)


  Fly    43 IKGGYLLRYKKQMFWNRWAEEWVVLYDDSTMAWFTEPGRSSPTGKILVKEA-------------- 93
            :|.|:|.|....:  .||...|..|:.|.:..::....|.....|:.:|.:              
Zfish     5 LKSGWLWRQSSVL--KRWKLNWCDLWIDGSFVFYKSESRRDYETKVNLKSSCVNVRSGLECAGVG 67

  Fly    94 -PEMLAIAHWTGQIPRRPPLPAGVNVSQLIALGSQRKRSKVYWMLAKSEQEVSDWIDAITKTLPP 157
             ||    :|     ||...|...:....:::|            .|.||.|...|          
Zfish    68 PPE----SH-----PRENLLVVYLRDGTMLSL------------CANSEDEALAW---------- 101

  Fly   158 PPQIELVVDKPHLMNVLRRPLVRIRPATQS----EVKQRKAA----SHGASGSKH---HRCS 208
                     |..||...|.|:....|...:    .:....|.    ..|..|::|   ||.|
Zfish   102 ---------KLTLMEAKRNPVFTYNPYDDTYQTVPIDSHNAVYIMPGTGCGGTQHVWVHRDS 154

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11000NP_001097690.1 PH 43..156 CDD:278594 24/128 (19%)
PH 43..155 CDD:214574 24/127 (19%)
si:ch211-176g13.7XP_009303850.1 PH_evt 2..109 CDD:270085 27/146 (18%)
PH 4..110 CDD:278594 27/147 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR14309
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.