DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11000 and PLEKHB2

Sequence 1:NP_001097690.1 Gene:CG11000 FlyBaseID:FBgn0263353 Length:332 Species:Drosophila melanogaster
Sequence 2:XP_011509687.1 Gene:PLEKHB2 HGNCID:19236 Length:244 Species:Homo sapiens

Alignment Length:271 Identity:55/272 (20%)
Similarity:88/272 (32%) Gaps:76/272 (28%)


  Fly    43 IKGGYLLRYKKQMFWNRWAEEWVVLYDDSTMAWFTEPGRSSPTGKILVKEAPEMLAIAHWTGQIP 107
            :|.|:|||  :.....||.:.|..|:.|..:.::.:..|.:...|:.:    .|..|...|||..
Human     4 VKSGWLLR--QSTILKRWKKNWFDLWSDGHLIYYDDQTRQNIEDKVHM----PMDCINIRTGQEC 62

  Fly   108 RRPPLPAGVN---VSQLIALGSQRKRSKVYWMLAKSEQEVSDW----IDAITKTL---------- 155
            |....|.|.:   :.|::.     :..|...:.|:|..:...|    .|:.|.|.          
Human    63 RDTQPPDGKSKDCMLQIVC-----RDGKTISLCAESTDDCLAWKFTLQDSRTNTAYVGSAVMTDE 122

  Fly   156 -----PPPPQIELVVDKPHLMNVLRRPLV--------RIRPATQSEVKQRKAASHGASGSKH--- 204
                 .|||........|.:...|.....        ...|.||        ..:.|:|..:   
Human   123 TSVVSSPPPYTAYAAPAPEVGRTLSLQQAYGYGPYGGAYPPGTQ--------VVYAANGQAYAVP 179

  Fly   205 -----------HRCSSAISTKVYRQSQDPLVKSDAAVAILSKKPDSKASLACALPWGHGWGWATL 258
                       .|..:|:|..:|  .|.|..:    |.|..:..|:.:.||..:..|...|.|. 
Human   180 YQYPYAETILMTRHCTAVSRGLY--GQQPANQ----VIIRERYRDNDSDLALGMLAGAATGMAL- 237

  Fly   259 PNGVWSGGLTW 269
                  |.|.|
Human   238 ------GSLFW 242

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11000NP_001097690.1 PH 43..156 CDD:278594 28/135 (21%)
PH 43..155 CDD:214574 28/119 (24%)
PLEKHB2XP_011509687.1 PH_evt 1..108 CDD:270085 26/115 (23%)
PH 4..100 CDD:278594 24/107 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR14309
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.