DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11000 and F38B7.3

Sequence 1:NP_001097690.1 Gene:CG11000 FlyBaseID:FBgn0263353 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_505929.1 Gene:F38B7.3 WormBaseID:WBGene00009534 Length:407 Species:Caenorhabditis elegans

Alignment Length:124 Identity:40/125 (32%)
Similarity:69/125 (55%) Gaps:5/125 (4%)


  Fly    41 KQIKGGYLLRYKKQMFWNRWAEEWVVLYDDSTMAWFTEPGRSSPTGKILVKEAPEMLAIAHWTGQ 105
            :::|.|.:|:|...:|.::|.:.:.||:.||.:.||...|...|.|.:|:|:....:.:...|.:
 Worm    19 RRLKDGEILKYTSGIFSSKWKKMYAVLFSDSRLVWFENRGDRKPKGSVLLKDVIPYICVGLMTDR 83

  Fly   106 IP-RRPPLPAGVNVSQLIALGSQRKRSKVYWMLAKSEQEVSDWIDAITKTLP----PPP 159
            :| :||.:|.|.:|..|:.:|...|....:|:|..|:.::..|...||||||    |||
 Worm    84 MPVKRPNVPEGNSVHHLVGIGMNPKADPCHWILFSSDSDIESWFTEITKTLPKPANPPP 142

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11000NP_001097690.1 PH 43..156 CDD:278594 36/114 (32%)
PH 43..155 CDD:214574 35/113 (31%)
F38B7.3NP_505929.1 PH 21..134 CDD:214574 35/113 (31%)
PH 22..134 CDD:278594 35/112 (31%)
DUF3824 <149..210 CDD:289625
WWbp <149..210 CDD:304964
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CBP9
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0013832
OrthoInspector 1 1.000 T476901
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR14309
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R17051
TreeFam 1 0.960
76.900

Return to query results.
Submit another query.