DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11000 and plekhb2

DIOPT Version :8

Sequence 1:NP_001097690.1 Gene:CG11000 / 40721 FlyBaseID:FBgn0263353 Length:332 Species:Drosophila melanogaster
Sequence 2:XP_012825541.1 Gene:plekhb2 / 100145492 XenbaseID:XB-GENE-983205 Length:249 Species:Xenopus tropicalis

Alignment Length:138 Identity:31/138 - (22%)
Similarity:56/138 - (40%) Gaps:32/138 - (23%)


  Fly    43 IKGGYLLRYKKQMFWNRWAEEWVVLYDDSTMAWFTEPGRSSPTGKILVKEAPEMLAIAHWTGQIP 107
            :|.|::||  :.....||.:.|..|:.:..:.::::..|.....||.::  .|.::|.  .|...
 Frog    36 VKSGWMLR--QSTILKRWKKNWFDLWSNGCLVYYSDQERQDMEDKIYMQ--TECISIR--VGNDC 94

  Fly   108 RRPPLPAGVNVS---QLIALGSQRKRSKVYWMLAKSEQEVSDW----IDAITKTL---------- 155
            |...||.|.|..   |::.     ...|:..::|:|..:...|    .||.||::          
 Frog    95 RDLNLPEGRNKDCCLQIVC-----HEGKLINLIAESADDCLAWETALKDARTKSVIVDSNLLYDE 154

  Fly   156 ----PPPP 159
                |.||
 Frog   155 AIYGPAPP 162

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11000NP_001097690.1 PH 43..156 CDD:278594 28/133 (21%)
PH 43..155 CDD:214574 28/118 (24%)
plekhb2XP_012825541.1 PH_evt 33..140 CDD:270085 25/114 (22%)
PH 36..139 CDD:278594 24/113 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.