DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11000 and plekhb2

Sequence 1:NP_001097690.1 Gene:CG11000 FlyBaseID:FBgn0263353 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_957296.1 Gene:plekhb2 ZFINID:ZDB-GENE-040426-754 Length:223 Species:Danio rerio

Alignment Length:129 Identity:28/130 (22%)
Similarity:55/130 (42%) Gaps:14/130 (11%)


  Fly    43 IKGGYLLRYKKQMFWNRWAEEWVVLYDDSTMAWFTEPGRSSPTGKILVKEAPEMLAIAHWTGQIP 107
            :|.|:|  :::.....||.:.|..|:.|..:.::.:..|.....:|.:|  .:.:.|.:.:....
Zfish     4 VKSGWL--HRQSTILRRWKKNWFDLWSDGRLVFYDDQQRRDMEDEIHMK--VDCINIRNASACRE 64

  Fly   108 RRPPLPAGV-NVSQLIALGSQRKRSKVYWMLAKSEQEVSDWI----DAITKTLPPPPQIELVVD 166
            ..||...|. ::.|::.     :..:|..:.|.|..:...|.    ||...|:..|||:..|.|
Zfish    65 LAPPEGKGKDSLLQIVC-----RDGRVISICADSADDALAWTMALQDARLNTVVAPPQMGFVED 123

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11000NP_001097690.1 PH 43..156 CDD:278594 23/118 (19%)
PH 43..155 CDD:214574 23/117 (20%)
plekhb2NP_957296.1 PH_evt 1..108 CDD:270085 22/113 (19%)
PH 4..107 CDD:278594 21/112 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR14309
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.