DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11000 and si:ch1073-83n3.2

Sequence 1:NP_001097690.1 Gene:CG11000 FlyBaseID:FBgn0263353 Length:332 Species:Drosophila melanogaster
Sequence 2:XP_017206603.1 Gene:si:ch1073-83n3.2 ZFINID:ZDB-GENE-141219-10 Length:285 Species:Danio rerio

Alignment Length:333 Identity:67/334 (20%)
Similarity:112/334 (34%) Gaps:102/334 (31%)


  Fly    46 GYLLRYKKQMFWNRWAEEWVVLYDDSTMAWFTEPGRSSPTGKILVKEAP-EMLAIAHWTGQIPRR 109
            |:|.:|...|| .:|.|:::||..:..:....:  ..:|..:::..::. |.|........:||.
Zfish     9 GFLRKYGGFMF-KQWKEKYLVLTVEGNLMVCRD--ADAPADQVVALQSHCESLVEGREILDLPRL 70

  Fly   110 PPLPAGVNVSQLIALGSQR--------KRSKVYWMLAKSEQEVSDWI-------DAITKTLPPPP 159
            ||             |.:|        .:.|...:||...:|.|.|:       :.:|..|....
Zfish    71 PP-------------GGRRDCCFAIILNQDKFILLLADGPEECSQWLKLLRKVKEGVTSPLALKR 122

  Fly   160 QIEL---VVDKPHLMNV----------LRRPLVRIRPAT---QSEVKQRKAAS---------HGA 199
            |..:   :.|:..|.::          |..||:|.|..:   :..:.||...|         |.:
Zfish   123 QQSITPCITDRETLSDLSSDRDPSSPHLNSPLLRSRENSFRHRGSITQRPPRSPTLAPAPALHSS 187

  Fly   200 SGSKHHRCSSAISTKVYRQSQDPLVKSDAAVAILSKKPDSKASLACALPWGHGWGWATLPNGVWS 264
            ...:|...|.|.:.:...........| :|:..|:..|.:.||                      
Zfish   188 DCLRHGNSSDARAVRAVCLLMGGAAAS-SALGYLNSCPPAAAS---------------------- 229

  Fly   265 GGLTWSQCEDTFTLHALPTTHCTNLIDT-----SCSGAVYHTDIGGFDFHSSGVDDIGGEDFDYA 324
                     ....:.|...:|.|...|:     :||.|:.......|||.       |..||| |
Zfish   230 ---------SNMVVRAPDISHSTGFSDSGASYHACSQAIESPHFNSFDFE-------GDSDFD-A 277

  Fly   325 MDCGDFIF 332
            .|||.|.|
Zfish   278 FDCGGFAF 285

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11000NP_001097690.1 PH 43..156 CDD:278594 26/126 (21%)
PH 43..155 CDD:214574 25/125 (20%)
si:ch1073-83n3.2XP_017206603.1 PH 5..112 CDD:278594 24/119 (20%)
PH 5..110 CDD:214574 24/117 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR14309
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.