DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10979 and ZNF800

DIOPT Version :8

Sequence 1:NP_001262301.1 Gene:CG10979 / 40720 FlyBaseID:FBgn0037379 Length:959 Species:Drosophila melanogaster
Sequence 2:XP_006715930.1 Gene:ZNF800 / 168850 HGNCID:27267 Length:726 Species:Homo sapiens

Alignment Length:857 Identity:175/858 (20%)
Similarity:294/858 (34%) Gaps:276/858 (32%)


  Fly     1 MRKRSSRCNSDTFKEEQMDHNG----------DDISLLQRPLRTAHTGFEEARRAYEDGTSEVRQ 55
            |..|...|.:|      ..|:|          .|..|||:||:|:.:|.::....:..||.:::.
Human     1 MPLRDKYCQTD------HHHHGCCEPVYILEPGDPPLLQQPLQTSKSGIQQIIECFRSGTKQLKH 59

  Fly    56 LLSLECSLIYECKVCRNMFRSLANFISHKRVFCCVSAR-SANGSGYTDQNSTMI--IQTGGGPSP 117
            :|..:...|:|||:||::||.|.|.|:||:.:|..|.: ..|.....|:.|..|  :.....||.
Human    60 ILLKDVDTIFECKLCRSLFRGLPNLITHKKFYCPPSLQMDDNLPDVNDKQSQAINDLLEAIYPSV 124

  Fly   118 QDIEHMLR------SRSTGCSPVPRDVRPLRGGGGGGIRDLSGVIERLR---REKATSQAKCSSP 173
            ...|::::      :::.....:.|...|:.      :.:.|...|:..   :|.:|.|:|....
Human   125 DKREYIIKLEPIETNQNAVFQYISRTDNPIE------VTESSSTPEQTEVQIQETSTEQSKTVPV 183

  Fly   174 TVLQLESV-PNSSQAVYQTIKVDHDDSIRTELDEVHRMLNPSETIVGPDGKALATVKLENNAGSD 237
            |..::|:| |...:.|        .|.:....||     .|.|          :...||.:..||
Human   184 TDTEVETVEPPPVEIV--------TDEVAPTSDE-----QPQE----------SQADLETSDNSD 225

  Fly   238 SGEQSISDETEPSIFCEICNLTFQTHKTLEVHIQKHH------------------------SSSA 278
            .|.|         :.|.:|...|.:.:.:..||:|.|                        |.:.
Human   226 FGHQ---------LICCLCRKEFNSRRGVRRHIRKVHKKKMEELKKYIETRKNPNQSSKGRSKNV 281

  Fly   279 FV---FQCPACSLTFLQAAAVIRHLSKDHKKPTRRIRMMRNTILKRRIQQGDVQPKGPCRELKRL 340
            .|   ..||.|..:|...|.|.||..:.|                              |.|:|.
Human   282 LVPLSRSCPVCCKSFATKANVRRHFDEVH------------------------------RGLRRD 316

  Fly   341 QLSDDVVGYVPEPL------------------DASGEHRKIMSLCIYCEKSFERRAALSTHLLNC 387
            .::.|:.....:||                  .:..|:......|:.|::.:..:..|..|:   
Human   317 SITPDIATKPGQPLFLDSISPKKSFKTRKQKSSSKAEYNLTACKCLLCKRKYSSQIMLKRHM--- 378

  Fly   388 RAKQEALAKPAPSVKKLKMKSNDSSVDAADEDPTTSIDLPKKKPIKTEEITLNEMFADLPEPNDS 452
                       ..|.|:.:...:|..:....:...|.::..|                 .||.||
Human   379 -----------QIVHKITLSGTNSKREKGPNNTANSSEIKVK-----------------VEPADS 415

  Fly   453 FAPGLHTVSLDQLNLGNVSDSASDE--ASNTDDEHELTPGAGPES-NADAEDVK-------GKAK 507
            .          :.:..:::.|..:|  .:|..:|.:.||.|.... ..|:|..|       |..:
Human   416 V----------ESSPPSITHSPQNELKGTNHSNEKKNTPAAQKNKVKQDSESPKSTSPSAAGGQQ 470

  Fly   508 KKRNVPVE-----KQLRCRCKICHKQFNALGNLRRHISMF----HYRARRFGCNLCEYRAFRRYD 563
            |.|...:.     |||  .||:|.:||.:..||.:||.:.    :...:.:.|.||.|...|:.|
Human   471 KTRKPKLSAGFDFKQL--YCKLCKRQFTSKQNLTKHIELHTDGNNIYVKFYKCPLCTYETRRKRD 533

  Fly   564 IVNHLGFTHK---------------------IEGDRDQLTEQYVSTHECEYSRDDVDGDIILLDK 607
            ::.|:...||                     |:...:::.::..|..|.::|....||       
Human   534 VIRHITVVHKKSSRYLGKITASLEIRAIKKPIDFVLNKVAKRGPSRDEAKHSDSKHDG------- 591

  Fly   608 EEELTVMEKDAKPPIKTYERRLKHLKTLTESVG-EVQ----------PKSPTAAIKEEPGQEPLE 661
                     .:..|.|.||         ...|| ||:          .|...|..|:...:.   
Human   592 ---------TSNSPSKKYE---------VADVGIEVKVTKNFSLHRCNKCGKAFAKKTYLEH--- 635

  Fly   662 GTPTPSKKRRKSRTQISPESGEHSQEKRPIRKRVKAVNKDFVYDLVSFKP--DGSCQQPPGA--- 721
                 .||..|:....||| |..::.:....|.:..:.|.......:.:|  .||...|.||   
Human   636 -----HKKTHKANASNSPE-GNKTKGRSTRSKALVCLAKPSSRSAAALRPAAPGSRCLPAGAVTT 694

  Fly   722 -QAVESMRAKLR 732
             ||..|.|||||
Human   695 RQAAASCRAKLR 706

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10979NP_001262301.1 C2H2 Zn finger 253..273 CDD:275368 6/20 (30%)
C2H2 Zn finger 283..300 CDD:275368 8/17 (47%)
C2H2 Zn finger 522..543 CDD:275368 9/25 (36%)
ZNF800XP_006715930.1 zf-C2H2_11 355..383 CDD:293228 5/42 (12%)
zf-C2H2_assoc2 391..485 CDD:293230 21/121 (17%)
C2H2 Zn finger 488..508 CDD:275370 9/20 (45%)
C2H2 Zn finger 521..540 CDD:275370 7/19 (37%)
zf-C2H2 618..640 CDD:278523 5/30 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C339762259
eggNOG 1 0.900 E33208_3BCDC
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 94 1.000 Inparanoid score I4992
Isobase 1 0.950 0 Normalized mean entropy S8377
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006111
OrthoInspector 1 1.000 T1074543
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR21020
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.