DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2046 and psmg1

Sequence 1:NP_649590.1 Gene:CG2046 FlyBaseID:FBgn0037378 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001002714.1 Gene:psmg1 ZFINID:ZDB-GENE-040718-469 Length:277 Species:Danio rerio

Alignment Length:260 Identity:52/261 (20%)
Similarity:86/261 (33%) Gaps:82/261 (31%)


  Fly     6 FGELNIPSSRAFWDDCDED-------------ELENLKPVEKLQLKFDDDCDGEAAPVESEMLVV 57
            |||:....|||..:|..||             |:|..:.||...|....|     .|::...|::
Zfish     5 FGEVLSVYSRAVEEDEYEDMTNENEEDEQIRREIEEKRSVEVCWLLGSQD-----GPLQCSDLII 64

  Fly    58 IEGVNVTHFASSLLEKDAKRVCAIPANNSTLHWSHSSKQLLAIINEDLTSSGEVAELLLP----- 117
            ..|.|.:.|..:.|             .||:.|  ::...|:..||  .|.|.....::|     
Zfish    65 GAGPNASGFIRAYL-------------LSTVGW--TAVAWLSFWNE--RSRGSERPTVVPGPGEP 112

  Fly   118 --YVKLAKKVITLTLKPKVEFKSEDIQLYRDHIAVVRGIGANQKDIT------------------ 162
              .:...:...|:.:.....|.:|| ||::....|...:.....::|                  
Zfish   113 SCVLYRLESCPTVLICQCQGFVAED-QLFQFTEKVFSCVQTRDLNVTILSDCSSADYKTSDYLSG 176

  Fly   163 ---------------------ELEAPNFIAGVAAGVASWRDQMELPVTSFVIYTDKLPLDATAAQ 206
                                 .||.||..:|:||.|.|.....::....:..|:|.|..|:.:.|
Zfish   177 SSTPFLRCLKTSTYTHTVTCPPLEQPNICSGLAAAVLSHCQVHQISAVLYQCYSDVLHPDSASMQ 241

  Fly   207  206
            Zfish   242  241

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2046NP_649590.1 None
psmg1NP_001002714.1 PAC1 1..276 CDD:292712 52/261 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1232038at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR15069
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.