DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2046 and psmg1

Sequence 1:NP_649590.1 Gene:CG2046 FlyBaseID:FBgn0037378 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001096329.1 Gene:psmg1 XenbaseID:XB-GENE-494236 Length:287 Species:Xenopus tropicalis

Alignment Length:276 Identity:60/277 (22%)
Similarity:111/277 (40%) Gaps:69/277 (25%)


  Fly     6 FGELNIPSSRAFWDDCD----EDELENLKPVEKLQLKFD-------------DDCDGEAAPVESE 53
            |||:....|||..:|.:    |:|.|:.:.:.:|:.|.:             :.......|..:.
 Frog     5 FGEVQSVFSRAVDEDDEEEEGEEEEEDREIIAELERKREVHVTWNPEVTAAIESSPNRRLPCSNV 69

  Fly    54 MLVVIEGVNVTHFASS-LLEKDAKRVC------------------AIPANNS-TLHWSHSSKQLL 98
            :|.|  |.|.|.|.|| :|...:..||                  ::||.:| |.:.|.:...:|
 Frog    70 ILSV--GDNATGFVSSYILSSGSWEVCGSITLWNERCRDCNPRKDSLPAPSSCTFYRSITDPTVL 132

  Fly    99 -----AIINED--------LTSSGEVAELLLPYVKLAKKVITLTLKPKVEFKSEDIQLYRDHIAV 150
                 :.|.||        :..|.|.:.|         .|..|:..|..|:|:.: ..|...:..
 Frog   133 LCQCNSYIAEDQLFQWCEKVFGSLEKSSL---------NVTVLSTCPVSEYKTPE-STYSLPVPF 187

  Fly   151 VRGIGANQ--KDI--TELEAPNFIAGVAAGVASWRDQMELPVTSFVIYTDKLPLDA---TAAQPV 208
            ::.:..::  :::  ..||.||...|:.|.|.::....::|...:..|||...||:   .|.:|:
 Frog   188 LKALRTSEYREEVPCPLLEQPNIADGLPAAVLTYCQVWQIPAVFYRCYTDLSKLDSITIDAFRPL 252

  Fly   209 IKVLKAAGVACSSSYI 224
            :...:.:.:|..|:.|
 Frog   253 LSCQRMSRLAADSAKI 268

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2046NP_649590.1 None
psmg1NP_001096329.1 PAC1 1..286 CDD:318342 60/277 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1232038at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.