DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: jagn and jagn1

Sequence 1:NP_649585.1 Gene:jagn FlyBaseID:FBgn0037374 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001001898.1 Gene:jagn1 XenbaseID:XB-GENE-5948803 Length:183 Species:Xenopus tropicalis

Alignment Length:195 Identity:59/196 (30%)
Similarity:97/196 (49%) Gaps:14/196 (7%)


  Fly     1 MATRGGPMVAGTDGNDFEFRQRVAGTYQISLLNKSRLKYCIFFHALLFFVMLAKLTSDILDHLDI 65
            ||:|.||...||||:||:.|:|||..||:|...|:.:|..|:.|.:::.::.|::   .:.||.:
 Frog     1 MASRAGPRATGTDGSDFQHRERVASHYQMSASLKNEIKKLIYAHLVIWLLIAAQM---CVSHLKL 62

  Fly    66 FVLEIEELEVPPPLWWEYVWAASLLTSFLGLSAARGNKVREMQKYMVAILLFAILPLFYCFAYYF 130
            ...::    |..|..|||.:..||:.|..||.:...|.:..:...|::..||:|.||.|.....|
 Frog    63 VSKDL----VAMPYQWEYPYLLSLVPSLFGLVSFPRNNISYLVISMISTGLFSIAPLIYGTLEMF 123

  Fly   131 SDVWEFATLDKSVELDETDIFVWRGYPYGVFWYAFCFVGFQVHGFTLYFAYNLVKAWKARTATRK 195
            ....:.....|:..      |:: |:......|....|..||||:.:|::..|:.||...|..:|
 Frog   124 PMAQQLYRHGKAYR------FIF-GFSAISVMYLLMVVAVQVHGWQIYYSKKLLDAWFTNTQEKK 181

  Fly   196  195
             Frog   182  181

Known Domains:


GeneSequenceDomainRegion External IDIdentity
jagnNP_649585.1 Jagunal 1..188 CDD:284495 57/187 (30%)
jagn1NP_001001898.1 Jagunal 1..174 CDD:311194 57/187 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I4856
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1452436at2759
OrthoFinder 1 1.000 FOG0004997
OrthoInspector 1 1.000 T1059116
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2589
TreeFam 00.000 Not matched by this tool.
66.090

Return to query results.
Submit another query.