DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Madm and Wnk1

Sequence 1:NP_001303420.1 Gene:Madm FlyBaseID:FBgn0027497 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_001186013.1 Gene:Wnk1 MGIID:2442092 Length:2635 Species:Mus musculus

Alignment Length:695 Identity:167/696 (24%)
Similarity:265/696 (38%) Gaps:223/696 (32%)


  Fly    13 STVADEPIQHHPSLAAGP--------VSASCPAAT----PPSQ-----STQQPPPHIVSASTADA 60
            :|||.: :...||.||.|        .:.:.|::|    |.||     |.::|||     |.:.:
Mouse   125 ATVASQ-VSQQPSAAASPGEQAVVGSATTTVPSSTSKDRPVSQPSLVGSKEEPPP-----SRSGS 183

  Fly    61 GSSAAVGVGVVAGSEGVNLDSSPRESGDDSEDESEILEE--------SPCGRWLKRREEVDQRDV 117
            ||..|                |.:|:.:|...:.:.:||        |..||:||...|:.:   
Mouse   184 GSGGA----------------SAKEAQEDRSQQQDDIEELETKAVGMSNDGRFLKFDIEIGR--- 229

  Fly   118 PGIDCVHLAMDTEEGVEVVWNEVQYASLQELKSQEEKMRQVFDNLLQLDHQNIVKFHRYWTDTQQ 182
            .....|:..:|||..|||.|.|:|...|  .||:.::.::..:.|..|.|.|||:|:..|..|.:
Mouse   230 GSFKTVYKGLDTETTVEVAWCELQDRKL--TKSERQRFKEEAEMLKGLQHPNIVRFYDSWESTVK 292

  Fly   183 AERPRVVFITEYMSSGSLKQFLKRTKRNAKRLPLESWRRWCTQILSALSYLHSCSPPIIHGNLTC 247
            .:: .:|.:||.|:||:||.:|||    .|.:.::..|.||.|||..|.:||:.:|||||.:|.|
Mouse   293 GKK-CIVLVTELMTSGTLKTYLKR----FKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKC 352

  Fly   248 DSIFIQ-HNGLVKIG--------------SVVPDAVHYSVRRGRERERERERGAHYFQAPEYGAA 297
            |:|||. ..|.||||              ||:                    |...|.|||. ..
Mouse   353 DNIFITGPTGSVKIGDLGLATLKRASFAKSVI--------------------GTPEFMAPEM-YE 396

  Fly   298 DQLTAALDIYAFGMCALEMAALE-------------------IQPSNSESTAINEETIQRTIFSL 343
            ::...::|:||||||.||||..|                   ::|::.:..||.|          
Mouse   397 EKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPE---------- 451

  Fly   344 ENDLQRDLIRKCLNPQPQDRPSANDLLFHPLLFEVHSLKLLTAHCLVFSPANRTMFSETAFDGLM 408
                .:::|..|:.....:|.|..|||.|....|                       ||.     
Mouse   452 ----VKEIIEGCIRQNKDERYSIKDLLNHAFFQE-----------------------ETG----- 484

  Fly   409 QRYYQPDVVMAQLRLAGGQERQYRLADVSGADKLEKFVEDVKYGVYPLITYSGKKPPNFRSRAAS 473
                      .::.||...:.:      ..|.||...:||:|       ...||...|.....:.
Mouse   485 ----------VRVELAEEDDGE------KIAIKLWLRIEDIK-------KLKGKYKDNEAIEFSF 526

  Fly   474 PERADSVKSATPEPVD----------TESRRIVNMMCSVKIKEDSNDITMTILLRMDDKMNRQLT 528
            ....|..:....|.|:          |.::.|.:.:..:|.|.:...     |:|.:.:..:|..
Mouse   527 DLERDVPEDVAQEMVESGYVCEGDHKTMAKAIKDRVSLIKRKREQRQ-----LVREEQEKRKQEE 586

  Fly   529 C---QVNEND-----------------------TAADLTSELVRLGFVHLDDQDKIQVLLEETLK 567
            .   |.||..                       |:|.:::::.    ....:.|:.|.|..:...
Mouse   587 SSFKQQNEQQASVSQAGIQQLSAASTGIPTAPATSASVSTQVE----PEEPEADQHQQLQYQQPS 647

  Fly   568 AGVMSDGAGAESSGAGVTTTATMAALEQLERNWSISSDADKQGTA 612
            ..|:|||......|:.|.|.:.::: :|.....|....|...|||
Mouse   648 ISVLSDGTIDSGQGSSVFTESRVSS-QQTVSYGSQHEQAHSTGTA 691

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MadmNP_001303420.1 PK_NRBP1_like 114..376 CDD:270886 90/296 (30%)
S_TKc 123..375 CDD:214567 90/286 (31%)
Wnk1NP_001186013.1 STKc_WNK1 195..483 CDD:270932 101/356 (28%)
S_TKc 226..479 CDD:214567 91/298 (31%)
Autoinhibitory domain. {ECO:0000250|UniProtKB:Q9JIH7} 488..555 15/80 (19%)
OSR1_C 500..537 CDD:289010 9/44 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92311412
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.