DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Madm and Nrbp1

Sequence 1:NP_001303420.1 Gene:Madm FlyBaseID:FBgn0027497 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_001334255.1 Gene:Nrbp1 MGIID:2183436 Length:543 Species:Mus musculus

Alignment Length:576 Identity:282/577 (49%)
Similarity:372/577 (64%) Gaps:63/577 (11%)


  Fly     1 MSNSQANAGISGSTVADEPIQHHPSLAAGPVSASCPAATPPSQSTQQPPPHIVSASTADAGSSAA 65
            ||..::...:|..:   :|.....|||.|..|.|     ||..||                :|||
Mouse     1 MSEGESQTVVSSGS---DPKVESSSLAPGLTSVS-----PPVTST----------------TSAA 41

  Fly    66 VGVGVVAGSEGVNLDSSPRESGDDSEDESEILEESPCGRWLKRREEVDQRDVPGIDCVHLAMDTE 130
                            ||.|. ::||||||||||||||||.||||||:||:|||||..:||||||
Mouse    42 ----------------SPEEE-EESEDESEILEESPCGRWQKRREEVNQRNVPGIDSAYLAMDTE 89

  Fly   131 EGVEVVWNEVQYASLQELKSQEEKMRQVFDNLLQLDHQNIVKFHRYWTDTQQAERPRVVFITEYM 195
            |||||||||||::..:..|.||||:|.|||||:||:|.||||||:||.|.:: .:.||:||||||
Mouse    90 EGVEVVWNEVQFSERKNYKLQEEKVRAVFDNLIQLEHLNIVKFHKYWADVKE-NKARVIFITEYM 153

  Fly   196 SSGSLKQFLKRTKRNAKRLPLESWRRWCTQILSALSYLHSCSPPIIHGNLTCDSIFIQHNGLVKI 260
            ||||||||||:||:|.|.:..::|:||||||||||||||||.|||||||||||:||||||||:||
Mouse   154 SSGSLKQFLKKTKKNHKTMNEKAWKRWCTQILSALSYLHSCDPPIIHGNLTCDTIFIQHNGLIKI 218

  Fly   261 GS--------VVPDAVHYSVRRGRERERERERGAHYFQAPEYGAADQLTAALDIYAFGMCALEMA 317
            ||        |.||.::..|:..    ||.::..|:| |||||....:|.|:|||:|||||||||
Mouse   219 GSVFHRIFANVAPDTINNHVKTC----REEQKNLHFF-APEYGEVTNVTTAVDIYSFGMCALEMA 278

  Fly   318 ALEIQPSNSESTAINEETIQRTIFSLENDLQRDLIRKCLNPQPQDRPSANDLLFHPLLFEVHSLK 382
            .|||| .|.||:.:.:|.|...|..||:.|||:.|:|||..:|..||:|.:|||||.||||.|||
Mouse   279 VLEIQ-GNGESSYVPQEAISSAIQLLEDSLQREFIQKCLQSEPARRPTARELLFHPALFEVPSLK 342

  Fly   383 LLTAHCLVFSPANRTMFSETAFDGLMQRYYQPDVVMAQLRLAGGQERQYRLADVSGADKLEKFVE 447
            ||.|||:|   .::.|..|.|.:.:.:. .....|:|::....|:|....|...|.|.:|:||:|
Mouse   343 LLAAHCIV---GHQHMIPENALEEITKN-MDTSAVLAEIPAGPGREPVQTLYSQSPALELDKFLE 403

  Fly   448 DVKYGVYPLITYSGKKP--PNFRSRAASPERADSVKSATPEPVDTESRRIVNMMCSVKIKEDSND 510
            ||:.|:|||..:...:|  |. :....||....|||:.||||.:.|:|::|.|.|:::..|:...
Mouse   404 DVRNGIYPLTAFGLPRPQQPQ-QEEVTSPVVPPSVKTPTPEPAEVETRKVVLMQCNIESVEEGVK 467

  Fly   511 ITMTILLRMDDKMNRQLTCQVNENDTAADLTSELVRLGFVHLDDQDKIQVLLEETL 566
            ..:|:||:::||:||.|:|.:..|::..||.:|||:|||:...||.::..||||||
Mouse   468 HHLTLLLKLEDKLNRHLSCDLMPNESIPDLAAELVQLGFISEADQSRLTSLLEETL 523

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MadmNP_001303420.1 PK_NRBP1_like 114..376 CDD:270886 165/270 (61%)
S_TKc 123..375 CDD:214567 157/260 (60%)
Nrbp1NP_001334255.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92352496
eggNOG 1 0.900 E1_KOG1266
Hieranoid 1 1.000
Homologene 1 1.000 H8373
Inparanoid 1 1.050 516 1.000 Inparanoid score I1270
Isobase 1 0.950 0 Normalized mean entropy S2457
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002306
OrthoInspector 1 1.000 T617202
orthoMCL 1 0.900 OOG5_133419
Panther 1 1.100 O PTHR13902
Phylome 1 0.910 0.600 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3170
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.