DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1236 and YPL113C

Sequence 1:NP_649579.2 Gene:CG1236 FlyBaseID:FBgn0037370 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_015212.1 Gene:YPL113C SGDID:S000006034 Length:396 Species:Saccharomyces cerevisiae

Alignment Length:381 Identity:84/382 (22%)
Similarity:138/382 (36%) Gaps:90/382 (24%)


  Fly    15 IQGHI--IRRMSSQHKVYVTRPDVDDSGLELLRKSCQVSTWHETNPVPRSELIRVVAGKDALYCA 77
            :..|:  .|:::.:.:.|.......|..::.|..       |..|....:|....|.|..:.|. 
Yeast    28 VASHLPEYRKLAERVEFYKYEMSTKDDFVKFLET-------HRINGFWLTEEFFTVLGNPSSYI- 84

  Fly    78 LTDKVDKEVLDAAGPQLKCVATISVGYDHIDVEECRKRGIRVGFTPDVLTDATAELTLALLLA-- 140
                   |...|:   ||.:....||.|.||.:..|.:||.:........|...||.:.|.::  
Yeast    85 -------EFFPAS---LKVILVPWVGCDFIDGKLLRSKGITLCNIGPHAADHVTELAIFLAISCF 139

  Fly   141 ------------------------------------------------------TNRRLFEANKQ 151
                                                                  .:|::....::
Yeast   140 RMTSFWEYCFKYVENGNVEQCKKYISSDSYEIVTDSYHGQEMKFPSRTDKCKPNKDRKVVHLAEK 204

  Fly   152 VYNGGWKSWAPMWMCGQGLKGSRVGLLGFGRIGQEIAARIVPFKPTEITYTTRSLRP--KEAAAV 214
            ...||.|..:||        ..:|.:||||.|||.|.:.:.......|.|..|: .|  |.....
Yeast   205 YTVGGKKMESPM--------NKKVLILGFGSIGQNIGSNLHKVFNMSIEYYKRT-GPVQKSLLDY 260

  Fly   215 NAR-HVDFDE--MLRESDLIVVCCALTPETKEIFNATAFQKMKPNCILINTARGGVVDQKALYEA 276
            ||: |.|.|:  ..:.:|||::....|..|..|.|..:....|....::|..||..:|:..|.:|
Yeast   261 NAKYHSDLDDPNTWKNADLIILALPSTASTNNIINRKSLAWCKDGVRIVNVGRGTCIDEDVLLDA 325

  Fly   277 LKTKRILAAGLDVTTPEPLPIDDPLLKLDNVVILPHIGSADIETRKEMSRITARNI 332
            |::.::.:.||||...|...:...||:..:|..||||||...:...:.:.||..|:
Yeast   326 LESGKVASCGLDVFKNEETRVKQELLRRWDVTALPHIGSTVADMVIKQTLITLENV 381

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1236NP_649579.2 GDH 27..338 CDD:240626 82/368 (22%)
LdhA 27..338 CDD:223980 82/368 (22%)
YPL113CNP_015212.1 Mand_dh_like 15..389 CDD:240645 84/382 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C65317352
eggNOG 1 0.900 E1_COG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR10996
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.890

Return to query results.
Submit another query.